FuNGI

A0A5N5KMA2

Protein Details

Accession

A0A5N5KMA2

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
403-422	GAEEQPPKRRRKSVRFSEKV	Basic

NLS Segment(s)

Position	Sequence
410-414	KRRRK

Subcellular Location(s)

nucl 14.5, cyto_nucl 11.833, cyto 8, cyto_mito 6.333

Family & Domain DBs

InterPro	View protein in InterPro IPR011856 tRNA_endonuc-like_dom_sf IPR036167 tRNA_intron_Endo_cat-like_sf IPR006677 tRNA_intron_Endonuc_cat-like IPR006676 tRNA_splic
Gene Ontology	GO:0005634 C:nucleus GO:0003676 F:nucleic acid binding GO:0000213 F:tRNA-intron endonuclease activity GO:0006388 P:tRNA splicing, via endonucleolytic cleavage and ligation
Pfam	View protein in Pfam PF01974 tRNA_int_endo
CDD	cd22363 tRNA-intron_lyase_C

Amino Acid Sequences

MADSKTTTSAPPPPMEAAPPSAEATADSQPRPQRPRGPPLHQIYALPAPIRTFPLPSFYPNNPLSLFHLVYAWAKQVLSPPPAEPSIHTGVWDPDTRSVHITDPVAVRAFWEQGFYGKGNLSRSEPNWLKREQIRRGSAQGDVSEQRTALRREERRQVKWERARVEQEALERTRREEAGLAAPVEEPETLEEAVVDEPVDVTEPVIEEGTTAPAVDDGESDASLNGVQTESHTHDSPPVLLDTPASPVADRVAEITALAVSQAVSSLPSVISSSPSIFKAPVGPLQLLALPNSAAESPVGPLELLALPNSLSDITDDYAKSSGLNGVPEGAEVQPPKRMRNDPLDTTALTGDGKEQEHGSGEESPRANGHTLDGHGNSSIFGDIVTGAVKPEVVLSKHAAPEGAEEQPPKRRRKSVRFSEKVQSTTFLHCDPPSPDRSAAKSNGTAVQLEAISIPKAAVTMQQEASAAQDKPKDAASMSKPLSETSSHPDIAEIENKEHLQLSTEEAFFLSYGIGALSIVDKDSNEQIPREKLLSLFRSHSYFPPAEELCPNDPFLVHYAVYHHFRSLGWVPRHGIKFGVDWMLYTRGPVFDHAEFGLIVQPSYSHPQWKELGQEAPRKSWHALHGVNRVLSHVLKSLVLVYVDIPPPAVFDAAMAKGGIPAALKEYKVREFMVRRWSSNRNR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.36
2	0.37
3	0.34
4	0.31
5	0.28
6	0.28
7	0.26
8	0.23
9	0.21
10	0.19
11	0.2
12	0.23
13	0.25
14	0.24
15	0.29
16	0.37
17	0.46
18	0.51
19	0.55
20	0.59
21	0.63
22	0.73
23	0.76
24	0.77
25	0.78
26	0.79
27	0.79
28	0.7
29	0.62
30	0.56
31	0.51
32	0.46
33	0.37
34	0.3
35	0.24
36	0.24
37	0.29
38	0.24
39	0.23
40	0.21
41	0.27
42	0.28
43	0.31
44	0.36
45	0.33
46	0.4
47	0.37
48	0.4
49	0.34
50	0.34
51	0.34
52	0.34
53	0.32
54	0.24
55	0.24
56	0.22
57	0.23
58	0.22
59	0.19
60	0.14
61	0.14
62	0.14
63	0.2
64	0.24
65	0.26
66	0.26
67	0.25
68	0.28
69	0.3
70	0.3
71	0.25
72	0.26
73	0.28
74	0.26
75	0.26
76	0.23
77	0.24
78	0.27
79	0.29
80	0.24
81	0.26
82	0.28
83	0.29
84	0.3
85	0.29
86	0.27
87	0.28
88	0.27
89	0.25
90	0.23
91	0.24
92	0.23
93	0.21
94	0.2
95	0.18
96	0.19
97	0.15
98	0.15
99	0.13
100	0.13
101	0.17
102	0.16
103	0.16
104	0.16
105	0.19
106	0.21
107	0.22
108	0.24
109	0.27
110	0.28
111	0.36
112	0.39
113	0.43
114	0.45
115	0.44
116	0.47
117	0.5
118	0.59
119	0.58
120	0.61
121	0.61
122	0.6
123	0.63
124	0.57
125	0.52
126	0.45
127	0.37
128	0.32
129	0.29
130	0.26
131	0.23
132	0.21
133	0.2
134	0.23
135	0.24
136	0.26
137	0.33
138	0.39
139	0.45
140	0.55
141	0.62
142	0.63
143	0.7
144	0.71
145	0.72
146	0.73
147	0.75
148	0.69
149	0.67
150	0.66
151	0.6
152	0.56
153	0.48
154	0.43
155	0.42
156	0.4
157	0.38
158	0.33
159	0.32
160	0.32
161	0.29
162	0.27
163	0.21
164	0.21
165	0.22
166	0.23
167	0.21
168	0.18
169	0.18
170	0.16
171	0.16
172	0.13
173	0.08
174	0.07
175	0.09
176	0.08
177	0.08
178	0.07
179	0.08
180	0.08
181	0.08
182	0.07
183	0.04
184	0.05
185	0.05
186	0.06
187	0.05
188	0.05
189	0.05
190	0.05
191	0.06
192	0.06
193	0.06
194	0.05
195	0.06
196	0.07
197	0.07
198	0.06
199	0.05
200	0.06
201	0.06
202	0.06
203	0.06
204	0.05
205	0.06
206	0.06
207	0.06
208	0.06
209	0.06
210	0.05
211	0.05
212	0.05
213	0.04
214	0.04
215	0.05
216	0.08
217	0.12
218	0.15
219	0.15
220	0.15
221	0.18
222	0.18
223	0.18
224	0.16
225	0.14
226	0.12
227	0.11
228	0.12
229	0.09
230	0.11
231	0.12
232	0.11
233	0.09
234	0.09
235	0.1
236	0.09
237	0.09
238	0.07
239	0.07
240	0.07
241	0.06
242	0.06
243	0.05
244	0.05
245	0.05
246	0.03
247	0.03
248	0.03
249	0.03
250	0.03
251	0.03
252	0.04
253	0.04
254	0.04
255	0.04
256	0.05
257	0.05
258	0.07
259	0.08
260	0.09
261	0.1
262	0.11
263	0.12
264	0.11
265	0.11
266	0.13
267	0.13
268	0.15
269	0.16
270	0.15
271	0.15
272	0.15
273	0.16
274	0.13
275	0.12
276	0.09
277	0.07
278	0.07
279	0.07
280	0.07
281	0.05
282	0.05
283	0.05
284	0.05
285	0.05
286	0.05
287	0.04
288	0.04
289	0.05
290	0.06
291	0.06
292	0.05
293	0.06
294	0.05
295	0.05
296	0.06
297	0.05
298	0.04
299	0.04
300	0.05
301	0.05
302	0.07
303	0.07
304	0.08
305	0.08
306	0.08
307	0.08
308	0.07
309	0.09
310	0.08
311	0.09
312	0.08
313	0.08
314	0.08
315	0.08
316	0.08
317	0.06
318	0.07
319	0.08
320	0.08
321	0.13
322	0.15
323	0.17
324	0.21
325	0.24
326	0.26
327	0.35
328	0.39
329	0.36
330	0.39
331	0.39
332	0.34
333	0.31
334	0.27
335	0.18
336	0.13
337	0.1
338	0.07
339	0.08
340	0.08
341	0.08
342	0.08
343	0.08
344	0.09
345	0.09
346	0.1
347	0.11
348	0.12
349	0.15
350	0.15
351	0.15
352	0.15
353	0.15
354	0.15
355	0.11
356	0.12
357	0.09
358	0.1
359	0.12
360	0.12
361	0.11
362	0.11
363	0.11
364	0.1
365	0.09
366	0.07
367	0.05
368	0.04
369	0.04
370	0.04
371	0.04
372	0.04
373	0.04
374	0.04
375	0.04
376	0.04
377	0.04
378	0.05
379	0.07
380	0.07
381	0.09
382	0.11
383	0.14
384	0.15
385	0.15
386	0.14
387	0.12
388	0.14
389	0.15
390	0.15
391	0.13
392	0.14
393	0.16
394	0.25
395	0.32
396	0.37
397	0.4
398	0.47
399	0.56
400	0.65
401	0.74
402	0.76
403	0.8
404	0.79
405	0.78
406	0.78
407	0.73
408	0.65
409	0.54
410	0.46
411	0.37
412	0.35
413	0.31
414	0.24
415	0.21
416	0.18
417	0.21
418	0.21
419	0.22
420	0.23
421	0.24
422	0.26
423	0.26
424	0.3
425	0.32
426	0.32
427	0.31
428	0.29
429	0.28
430	0.29
431	0.27
432	0.24
433	0.18
434	0.17
435	0.13
436	0.12
437	0.11
438	0.08
439	0.07
440	0.07
441	0.07
442	0.05
443	0.05
444	0.05
445	0.08
446	0.11
447	0.14
448	0.15
449	0.15
450	0.16
451	0.15
452	0.18
453	0.18
454	0.15
455	0.14
456	0.16
457	0.16
458	0.17
459	0.18
460	0.17
461	0.13
462	0.2
463	0.21
464	0.27
465	0.27
466	0.29
467	0.29
468	0.28
469	0.3
470	0.25
471	0.24
472	0.22
473	0.26
474	0.23
475	0.23
476	0.23
477	0.22
478	0.22
479	0.25
480	0.2
481	0.17
482	0.2
483	0.2
484	0.2
485	0.19
486	0.17
487	0.14
488	0.13
489	0.16
490	0.17
491	0.17
492	0.17
493	0.16
494	0.16
495	0.13
496	0.13
497	0.08
498	0.04
499	0.04
500	0.04
501	0.04
502	0.03
503	0.04
504	0.04
505	0.04
506	0.05
507	0.05
508	0.05
509	0.07
510	0.11
511	0.15
512	0.16
513	0.18
514	0.22
515	0.25
516	0.27
517	0.27
518	0.24
519	0.23
520	0.28
521	0.31
522	0.3
523	0.3
524	0.3
525	0.32
526	0.33
527	0.33
528	0.32
529	0.29
530	0.26
531	0.3
532	0.28
533	0.28
534	0.28
535	0.3
536	0.27
537	0.28
538	0.28
539	0.21
540	0.2
541	0.19
542	0.2
543	0.18
544	0.14
545	0.13
546	0.16
547	0.2
548	0.24
549	0.24
550	0.21
551	0.19
552	0.19
553	0.25
554	0.28
555	0.33
556	0.32
557	0.35
558	0.38
559	0.44
560	0.47
561	0.41
562	0.36
563	0.28
564	0.27
565	0.26
566	0.28
567	0.2
568	0.18
569	0.21
570	0.23
571	0.21
572	0.2
573	0.18
574	0.15
575	0.16
576	0.18
577	0.2
578	0.17
579	0.2
580	0.19
581	0.19
582	0.17
583	0.16
584	0.18
585	0.13
586	0.12
587	0.1
588	0.11
589	0.13
590	0.2
591	0.21
592	0.25
593	0.26
594	0.31
595	0.34
596	0.36
597	0.39
598	0.36
599	0.42
600	0.42
601	0.49
602	0.47
603	0.49
604	0.5
605	0.48
606	0.46
607	0.44
608	0.42
609	0.43
610	0.46
611	0.48
612	0.53
613	0.54
614	0.53
615	0.47
616	0.44
617	0.38
618	0.32
619	0.27
620	0.21
621	0.18
622	0.17
623	0.17
624	0.17
625	0.16
626	0.15
627	0.14
628	0.12
629	0.16
630	0.17
631	0.17
632	0.16
633	0.14
634	0.15
635	0.15
636	0.14
637	0.09
638	0.08
639	0.13
640	0.12
641	0.14
642	0.12
643	0.11
644	0.12
645	0.12
646	0.12
647	0.08
648	0.08
649	0.13
650	0.16
651	0.17
652	0.21
653	0.27
654	0.3
655	0.33
656	0.35
657	0.39
658	0.41
659	0.47
660	0.54
661	0.54
662	0.54
663	0.58

A0A5N5KMA2

3D AlphaFold-predicted Structure Viewer