Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5NIR6

Protein Details
Accession A0A5N5NIR6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
82-112CDICKKRFSQSRSRTKHKQREHKGYRFQLITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences CEKRLSTRSSLATHKRIYTEKKPFGYNIYGKRFYRGFHLITYRRIYTREKPFEYDICKIRVSDPSNLTSHKRIHTREKPFECDICKKRFSQSRSRTKHKQREHKGYRFQLITNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.54
4 0.58
5 0.59
6 0.61
7 0.62
8 0.61
9 0.61
10 0.58
11 0.56
12 0.55
13 0.52
14 0.5
15 0.5
16 0.53
17 0.51
18 0.53
19 0.49
20 0.42
21 0.41
22 0.37
23 0.3
24 0.28
25 0.36
26 0.35
27 0.39
28 0.42
29 0.37
30 0.33
31 0.35
32 0.36
33 0.36
34 0.44
35 0.47
36 0.45
37 0.46
38 0.48
39 0.49
40 0.48
41 0.44
42 0.36
43 0.31
44 0.29
45 0.26
46 0.25
47 0.27
48 0.26
49 0.27
50 0.27
51 0.27
52 0.29
53 0.3
54 0.32
55 0.3
56 0.31
57 0.3
58 0.34
59 0.36
60 0.45
61 0.52
62 0.59
63 0.65
64 0.66
65 0.67
66 0.65
67 0.65
68 0.6
69 0.6
70 0.57
71 0.54
72 0.51
73 0.47
74 0.52
75 0.56
76 0.56
77 0.57
78 0.61
79 0.66
80 0.72
81 0.79
82 0.82
83 0.85
84 0.89
85 0.88
86 0.89
87 0.89
88 0.91
89 0.93
90 0.92
91 0.92
92 0.89
93 0.87
94 0.78