Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MD74

Protein Details
Accession C5MD74   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SEEEINRKKRKKVYSAPSVNVHydrophilic
NLS Segment(s)
PositionSequence
9-12KKRK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021714  Npa1_N  
KEGG ctp:CTRG_04175  -  
Pfam View protein in Pfam  
PF11707  Npa1  
Amino Acid Sequences MSEEEINRKKRKKVYSAPSVNVDYSLIEQVNSITANKTPDIKLLSPFIESGSLVKLLSIWSYYSSTNDLSHLIDISSKISQITRQINELRDELLQFKQIIIDTYKDILNKHEKIIYRALNNMKPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.8
5 0.76
6 0.69
7 0.59
8 0.49
9 0.39
10 0.28
11 0.21
12 0.19
13 0.13
14 0.1
15 0.1
16 0.09
17 0.1
18 0.1
19 0.09
20 0.08
21 0.09
22 0.12
23 0.12
24 0.15
25 0.14
26 0.17
27 0.21
28 0.21
29 0.21
30 0.22
31 0.22
32 0.19
33 0.19
34 0.16
35 0.12
36 0.11
37 0.1
38 0.08
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.06
48 0.08
49 0.08
50 0.09
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.09
59 0.07
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.08
66 0.08
67 0.1
68 0.16
69 0.22
70 0.21
71 0.26
72 0.29
73 0.32
74 0.34
75 0.33
76 0.28
77 0.22
78 0.22
79 0.2
80 0.17
81 0.17
82 0.15
83 0.14
84 0.14
85 0.14
86 0.15
87 0.15
88 0.16
89 0.15
90 0.16
91 0.18
92 0.18
93 0.18
94 0.23
95 0.3
96 0.3
97 0.31
98 0.35
99 0.35
100 0.38
101 0.46
102 0.46
103 0.4
104 0.46
105 0.5