Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5L075

Protein Details
Accession A0A5N5L075    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TGEPVIEKRRKKDRTRLRCNWKDCRYSAHydrophilic
NLS Segment(s)
PositionSequence
19-22RRKK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MCEEINRVLSTGEPVIEKRRKKDRTRLRCNWKDCRYSASLLSELQLHLRQHWKCPKEDCGWDEARDEKEKRRHVWGSHKKWAEQIRYPTIGGKCSVCEKKFTRHDNLVRHIREKHAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.24
3 0.32
4 0.36
5 0.41
6 0.51
7 0.59
8 0.67
9 0.76
10 0.77
11 0.81
12 0.87
13 0.89
14 0.9
15 0.9
16 0.89
17 0.89
18 0.85
19 0.81
20 0.71
21 0.66
22 0.58
23 0.51
24 0.46
25 0.39
26 0.32
27 0.25
28 0.24
29 0.19
30 0.16
31 0.15
32 0.16
33 0.13
34 0.14
35 0.22
36 0.22
37 0.29
38 0.37
39 0.38
40 0.38
41 0.41
42 0.45
43 0.42
44 0.46
45 0.39
46 0.37
47 0.36
48 0.33
49 0.31
50 0.27
51 0.25
52 0.26
53 0.27
54 0.29
55 0.36
56 0.41
57 0.42
58 0.48
59 0.5
60 0.5
61 0.6
62 0.63
63 0.64
64 0.67
65 0.67
66 0.6
67 0.61
68 0.63
69 0.58
70 0.54
71 0.52
72 0.5
73 0.49
74 0.49
75 0.48
76 0.42
77 0.37
78 0.32
79 0.25
80 0.21
81 0.28
82 0.35
83 0.3
84 0.37
85 0.39
86 0.47
87 0.56
88 0.61
89 0.61
90 0.63
91 0.7
92 0.71
93 0.77
94 0.76
95 0.72
96 0.71
97 0.66