Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LJB7

Protein Details
Accession A0A5N5LJB7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-128AGMTTLKPRDRTKRKKNKKKKVVGGGAGKSGBasic
NLS Segment(s)
PositionSequence
104-127KPRDRTKRKKNKKKKVVGGGAGKS
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_mito 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAPLSHDEFFSKLTQLFAMHEGKDHGEVFLTQKRFSPSSPSSPPSDESSSPLTPAPILIRATDGQGKEDRPSKVKLSTLVQPDEIDAFYTRYAEICRAGMTTLKPRDRTKRKKNKKKKVVGGGAGKSGMKAVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.19
5 0.2
6 0.18
7 0.19
8 0.19
9 0.19
10 0.21
11 0.19
12 0.14
13 0.12
14 0.13
15 0.16
16 0.21
17 0.22
18 0.2
19 0.23
20 0.27
21 0.28
22 0.27
23 0.32
24 0.3
25 0.36
26 0.41
27 0.4
28 0.39
29 0.4
30 0.41
31 0.38
32 0.37
33 0.29
34 0.27
35 0.3
36 0.27
37 0.26
38 0.23
39 0.18
40 0.14
41 0.15
42 0.12
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.13
49 0.15
50 0.14
51 0.13
52 0.14
53 0.15
54 0.16
55 0.21
56 0.21
57 0.21
58 0.24
59 0.24
60 0.25
61 0.26
62 0.27
63 0.25
64 0.29
65 0.3
66 0.29
67 0.27
68 0.24
69 0.23
70 0.21
71 0.18
72 0.13
73 0.09
74 0.09
75 0.08
76 0.09
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.1
83 0.1
84 0.1
85 0.11
86 0.13
87 0.15
88 0.22
89 0.3
90 0.35
91 0.4
92 0.46
93 0.57
94 0.66
95 0.74
96 0.76
97 0.79
98 0.86
99 0.92
100 0.96
101 0.97
102 0.97
103 0.96
104 0.96
105 0.95
106 0.93
107 0.91
108 0.89
109 0.81
110 0.72
111 0.64
112 0.53
113 0.42