Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MA67

Protein Details
Accession C5MA67   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-54SLSDCRGDLPKKKKKKKENKKLKVKKANESHEKFBasic
NLS Segment(s)
PositionSequence
30-48PKKKKKKKENKKLKVKKAN
Subcellular Location(s) nucl 5.5, E.R. 5, cyto_nucl 4, pero 4, mito 3, extr 3, plas 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020266  Tom6  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0030150  P:protein import into mitochondrial matrix  
KEGG ctp:CTRG_02379  -  
Pfam View protein in Pfam  
PF17112  Tom6  
Amino Acid Sequences MEKRSDPIFFFSFFLFCCSSSLSDCRGDLPKKKKKKKENKKLKVKKANESHEKFSTKRELLALNSIANTQTISINMSGRFPPQGAKEEPSTFEQIKKSPAFIVGTQAVLFGLGVLFIQSPLMDMLVPQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.15
4 0.15
5 0.16
6 0.16
7 0.19
8 0.21
9 0.2
10 0.22
11 0.21
12 0.23
13 0.29
14 0.33
15 0.39
16 0.47
17 0.54
18 0.63
19 0.73
20 0.8
21 0.84
22 0.89
23 0.92
24 0.93
25 0.94
26 0.94
27 0.95
28 0.96
29 0.95
30 0.95
31 0.89
32 0.88
33 0.86
34 0.84
35 0.83
36 0.77
37 0.71
38 0.67
39 0.64
40 0.55
41 0.5
42 0.48
43 0.38
44 0.34
45 0.3
46 0.26
47 0.23
48 0.26
49 0.23
50 0.15
51 0.15
52 0.14
53 0.12
54 0.1
55 0.09
56 0.06
57 0.05
58 0.05
59 0.06
60 0.07
61 0.08
62 0.08
63 0.1
64 0.1
65 0.1
66 0.11
67 0.1
68 0.12
69 0.14
70 0.19
71 0.2
72 0.22
73 0.25
74 0.26
75 0.28
76 0.28
77 0.3
78 0.26
79 0.28
80 0.28
81 0.26
82 0.31
83 0.3
84 0.28
85 0.24
86 0.26
87 0.25
88 0.23
89 0.26
90 0.21
91 0.21
92 0.19
93 0.18
94 0.15
95 0.12
96 0.11
97 0.05
98 0.04
99 0.03
100 0.03
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.06
108 0.06
109 0.06