Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5P7B9

Protein Details
Accession A0A5N5P7B9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
287-310ATYSRKDKKGSTTRKTLRRMSQAPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF01151  ELO  
Amino Acid Sequences MATPEAISFYEKLPLPTIDRPFGIHLWPIFSKAFEAVVGYPAEDFRFVPGETPMSTLKETSIFIVIYYTIIFGGRWLMRDRKPFKLQSLFLIHNFYLTAISGLLLVLFIEQLLPVVARGGVFHAICHREGGWTQPLVVLYYLNYLTKYLELLDTCFLFLKKKPLTFLHCYHHGATALLCYTQLIGSTSVSWVPITLNLTVHVVMYWYYFQSARGIRIWWKEWITRLQILQFIIDLGFVYFASWTYFTSTYWDWLPNMGKCAGEEFAAISGICILSSYLLLFLSFYAATYSRKDKKGSTTRKTLRRMSQAPLPDPADIAHHKATNGDARSSAVKSNGSVRSRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.35
4 0.39
5 0.37
6 0.37
7 0.37
8 0.38
9 0.37
10 0.33
11 0.29
12 0.25
13 0.27
14 0.26
15 0.27
16 0.24
17 0.23
18 0.22
19 0.19
20 0.18
21 0.13
22 0.14
23 0.12
24 0.14
25 0.14
26 0.12
27 0.12
28 0.12
29 0.12
30 0.11
31 0.11
32 0.1
33 0.13
34 0.13
35 0.14
36 0.15
37 0.17
38 0.16
39 0.19
40 0.19
41 0.19
42 0.19
43 0.18
44 0.18
45 0.17
46 0.17
47 0.16
48 0.16
49 0.13
50 0.12
51 0.13
52 0.12
53 0.1
54 0.09
55 0.08
56 0.06
57 0.06
58 0.06
59 0.05
60 0.1
61 0.11
62 0.13
63 0.17
64 0.24
65 0.29
66 0.39
67 0.44
68 0.48
69 0.55
70 0.57
71 0.61
72 0.62
73 0.58
74 0.55
75 0.57
76 0.51
77 0.44
78 0.44
79 0.36
80 0.28
81 0.27
82 0.2
83 0.14
84 0.11
85 0.1
86 0.05
87 0.05
88 0.05
89 0.05
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.02
97 0.02
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.08
108 0.08
109 0.08
110 0.12
111 0.14
112 0.14
113 0.15
114 0.14
115 0.12
116 0.13
117 0.16
118 0.16
119 0.14
120 0.14
121 0.15
122 0.15
123 0.14
124 0.14
125 0.1
126 0.07
127 0.08
128 0.09
129 0.08
130 0.08
131 0.07
132 0.08
133 0.08
134 0.08
135 0.06
136 0.07
137 0.07
138 0.08
139 0.09
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.18
147 0.2
148 0.21
149 0.25
150 0.28
151 0.35
152 0.39
153 0.42
154 0.38
155 0.39
156 0.4
157 0.37
158 0.35
159 0.28
160 0.23
161 0.18
162 0.14
163 0.1
164 0.08
165 0.07
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.07
181 0.08
182 0.08
183 0.08
184 0.09
185 0.1
186 0.09
187 0.09
188 0.07
189 0.06
190 0.05
191 0.06
192 0.06
193 0.05
194 0.06
195 0.07
196 0.07
197 0.12
198 0.13
199 0.15
200 0.16
201 0.17
202 0.21
203 0.25
204 0.26
205 0.26
206 0.27
207 0.27
208 0.29
209 0.33
210 0.33
211 0.31
212 0.3
213 0.27
214 0.27
215 0.26
216 0.22
217 0.17
218 0.13
219 0.1
220 0.09
221 0.07
222 0.04
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.06
229 0.06
230 0.07
231 0.1
232 0.11
233 0.11
234 0.15
235 0.15
236 0.16
237 0.18
238 0.19
239 0.15
240 0.19
241 0.23
242 0.21
243 0.23
244 0.22
245 0.2
246 0.19
247 0.21
248 0.17
249 0.13
250 0.12
251 0.09
252 0.09
253 0.09
254 0.09
255 0.07
256 0.07
257 0.06
258 0.06
259 0.05
260 0.05
261 0.04
262 0.05
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.05
269 0.07
270 0.06
271 0.07
272 0.08
273 0.1
274 0.12
275 0.16
276 0.25
277 0.31
278 0.36
279 0.39
280 0.41
281 0.5
282 0.6
283 0.66
284 0.66
285 0.69
286 0.74
287 0.81
288 0.84
289 0.82
290 0.8
291 0.8
292 0.76
293 0.7
294 0.69
295 0.67
296 0.62
297 0.59
298 0.52
299 0.42
300 0.38
301 0.33
302 0.31
303 0.26
304 0.28
305 0.26
306 0.26
307 0.25
308 0.26
309 0.3
310 0.32
311 0.32
312 0.29
313 0.25
314 0.26
315 0.3
316 0.31
317 0.3
318 0.25
319 0.24
320 0.24
321 0.32
322 0.38
323 0.4