Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5PGX3

Protein Details
Accession A0A5N5PGX3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-79QLPKRAITSKQRTSNKPKSKLKAAMKHydrophilic
NLS Segment(s)
PositionSequence
68-74NKPKSKL
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF00383  dCMP_cyt_deam_1  
Amino Acid Sequences MKSDNYLNLCLEQASLSPFRHRHGCIVVKGGKVIGKGYNEFRSGYDGGALKTGQLPKRAITSKQRTSNKPKSKLKAAMKHSSSISSDFVPFEAVDGNGGGYLANRALTMHSEMMAINSALSSCGTSAATLVSQTKPYFKLSGLGAISGRLPRSSAIRAYVQQVCLAGQGQEVQRGAGSLQGQEWRFEAGAYQCGQESEERRLEEREEAQEQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.18
4 0.24
5 0.26
6 0.3
7 0.36
8 0.37
9 0.38
10 0.43
11 0.48
12 0.43
13 0.5
14 0.51
15 0.45
16 0.43
17 0.4
18 0.33
19 0.27
20 0.26
21 0.22
22 0.21
23 0.23
24 0.28
25 0.3
26 0.3
27 0.3
28 0.28
29 0.29
30 0.26
31 0.23
32 0.22
33 0.18
34 0.17
35 0.18
36 0.17
37 0.12
38 0.16
39 0.22
40 0.22
41 0.25
42 0.26
43 0.25
44 0.33
45 0.36
46 0.37
47 0.42
48 0.49
49 0.53
50 0.61
51 0.68
52 0.68
53 0.75
54 0.81
55 0.8
56 0.81
57 0.81
58 0.78
59 0.79
60 0.81
61 0.8
62 0.78
63 0.75
64 0.74
65 0.66
66 0.63
67 0.54
68 0.47
69 0.39
70 0.32
71 0.26
72 0.18
73 0.17
74 0.14
75 0.13
76 0.12
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.05
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.08
118 0.08
119 0.11
120 0.11
121 0.14
122 0.15
123 0.17
124 0.18
125 0.16
126 0.19
127 0.16
128 0.22
129 0.19
130 0.18
131 0.16
132 0.15
133 0.16
134 0.15
135 0.15
136 0.09
137 0.1
138 0.1
139 0.13
140 0.16
141 0.16
142 0.18
143 0.21
144 0.22
145 0.27
146 0.3
147 0.26
148 0.24
149 0.23
150 0.2
151 0.17
152 0.16
153 0.11
154 0.08
155 0.12
156 0.12
157 0.15
158 0.15
159 0.14
160 0.13
161 0.14
162 0.13
163 0.13
164 0.13
165 0.1
166 0.12
167 0.18
168 0.18
169 0.19
170 0.2
171 0.18
172 0.18
173 0.17
174 0.18
175 0.14
176 0.18
177 0.18
178 0.18
179 0.16
180 0.17
181 0.18
182 0.2
183 0.22
184 0.25
185 0.29
186 0.31
187 0.33
188 0.35
189 0.37
190 0.37
191 0.39
192 0.38