Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5M8U0

Protein Details
Accession A0A5N5M8U0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-68SYNDSKQPKKTPPKYQSQGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MHSSRVVQQYSLLSILLYLILLSLSYCIHRVDPRTTVRVASNPFLAPASYNDSKQPKKTPPKYQSQGCGIYALPFSSFPLNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.08
4 0.06
5 0.04
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.06
14 0.07
15 0.09
16 0.12
17 0.15
18 0.18
19 0.24
20 0.27
21 0.29
22 0.28
23 0.28
24 0.27
25 0.27
26 0.26
27 0.22
28 0.2
29 0.17
30 0.17
31 0.15
32 0.14
33 0.1
34 0.1
35 0.15
36 0.15
37 0.16
38 0.21
39 0.28
40 0.32
41 0.36
42 0.42
43 0.45
44 0.55
45 0.64
46 0.69
47 0.7
48 0.77
49 0.8
50 0.8
51 0.77
52 0.72
53 0.67
54 0.57
55 0.51
56 0.4
57 0.35
58 0.29
59 0.22
60 0.17
61 0.13
62 0.14