Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5JZG8

Protein Details
Accession A0A5N5JZG8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
166-195LRDFAAKKLDKGRNKKRKRASAIVKDDKPEBasic
NLS Segment(s)
PositionSequence
172-186KKLDKGRNKKRKRAS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSWKSSEPWEMPGFQFDKKLPRELTKVLQGHESTVLADFTVAEHSRDKLRALDCLVVLFQSMLSNSAIYRRSIKAFNELLSDDVDSGSKPWRLNHLWTRYISARRLFLKHNNSTWRSGSILTDLVDNWIEFLDGNTPGQRKEKASAPDPSSSEKLYISIEHDDQPLRDFAAKKLDKGRNKKRKRASAIVKDDKPETQEEPIRSLARSAKFRLPHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.3
4 0.36
5 0.37
6 0.44
7 0.41
8 0.45
9 0.5
10 0.51
11 0.54
12 0.54
13 0.54
14 0.47
15 0.48
16 0.42
17 0.38
18 0.35
19 0.29
20 0.2
21 0.18
22 0.16
23 0.1
24 0.1
25 0.08
26 0.06
27 0.11
28 0.11
29 0.12
30 0.13
31 0.15
32 0.19
33 0.2
34 0.21
35 0.21
36 0.22
37 0.24
38 0.25
39 0.26
40 0.23
41 0.22
42 0.21
43 0.15
44 0.14
45 0.1
46 0.08
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.11
54 0.12
55 0.13
56 0.17
57 0.17
58 0.2
59 0.24
60 0.25
61 0.28
62 0.28
63 0.28
64 0.27
65 0.25
66 0.22
67 0.2
68 0.18
69 0.11
70 0.09
71 0.09
72 0.06
73 0.07
74 0.09
75 0.11
76 0.12
77 0.13
78 0.2
79 0.22
80 0.29
81 0.36
82 0.39
83 0.4
84 0.4
85 0.43
86 0.4
87 0.42
88 0.38
89 0.32
90 0.3
91 0.29
92 0.31
93 0.3
94 0.34
95 0.38
96 0.39
97 0.42
98 0.44
99 0.44
100 0.45
101 0.43
102 0.36
103 0.29
104 0.26
105 0.21
106 0.16
107 0.15
108 0.12
109 0.11
110 0.09
111 0.09
112 0.09
113 0.08
114 0.07
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.09
123 0.1
124 0.12
125 0.15
126 0.18
127 0.18
128 0.2
129 0.27
130 0.29
131 0.33
132 0.39
133 0.39
134 0.41
135 0.41
136 0.42
137 0.38
138 0.33
139 0.3
140 0.22
141 0.2
142 0.17
143 0.16
144 0.15
145 0.16
146 0.17
147 0.18
148 0.19
149 0.19
150 0.18
151 0.19
152 0.17
153 0.15
154 0.17
155 0.17
156 0.17
157 0.27
158 0.28
159 0.3
160 0.4
161 0.47
162 0.52
163 0.62
164 0.71
165 0.72
166 0.81
167 0.87
168 0.88
169 0.9
170 0.9
171 0.89
172 0.89
173 0.89
174 0.9
175 0.89
176 0.83
177 0.75
178 0.68
179 0.6
180 0.52
181 0.44
182 0.37
183 0.34
184 0.37
185 0.36
186 0.37
187 0.4
188 0.39
189 0.36
190 0.37
191 0.36
192 0.37
193 0.41
194 0.43
195 0.46