Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5Q2C1

Protein Details
Accession A0A5N5Q2C1    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-90KLKNEKASSRKRGKRPASSTHydrophilic
150-171ASANASSKKRAKNRKAGLQALLHydrophilic
NLS Segment(s)
PositionSequence
70-100LKLKNEKASSRKRGKRPASSTVGKTPAVPRR
156-164SKKRAKNRK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MTAAETATHLNYLNDAAHLLAFTAPETSSYLMRQRHGLMFANEIELSATQRQHVCGACGRIMIPGQNSRLKLKNEKASSRKRGKRPASSTVGKTPAVPRRGAPAGPSKVFTCDNCGRYTKVQLPAPAPISRKKPSAAVTKMVETVKQPPASANASSKKRAKNRKAGLQALLSQAGGSGGAKSGLGLSLSDFMKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.08
6 0.08
7 0.07
8 0.06
9 0.06
10 0.07
11 0.07
12 0.08
13 0.1
14 0.11
15 0.11
16 0.14
17 0.21
18 0.23
19 0.24
20 0.26
21 0.28
22 0.3
23 0.32
24 0.33
25 0.28
26 0.28
27 0.27
28 0.26
29 0.22
30 0.19
31 0.16
32 0.12
33 0.13
34 0.13
35 0.13
36 0.13
37 0.15
38 0.16
39 0.19
40 0.19
41 0.18
42 0.19
43 0.22
44 0.2
45 0.2
46 0.19
47 0.17
48 0.17
49 0.16
50 0.15
51 0.16
52 0.19
53 0.23
54 0.24
55 0.27
56 0.32
57 0.34
58 0.39
59 0.42
60 0.47
61 0.49
62 0.56
63 0.61
64 0.65
65 0.71
66 0.74
67 0.75
68 0.75
69 0.8
70 0.79
71 0.81
72 0.77
73 0.75
74 0.72
75 0.67
76 0.62
77 0.56
78 0.52
79 0.42
80 0.36
81 0.35
82 0.34
83 0.32
84 0.29
85 0.24
86 0.26
87 0.28
88 0.26
89 0.23
90 0.25
91 0.27
92 0.27
93 0.28
94 0.23
95 0.24
96 0.26
97 0.23
98 0.23
99 0.24
100 0.26
101 0.27
102 0.28
103 0.28
104 0.28
105 0.33
106 0.31
107 0.32
108 0.33
109 0.34
110 0.34
111 0.35
112 0.36
113 0.35
114 0.32
115 0.31
116 0.34
117 0.35
118 0.36
119 0.33
120 0.34
121 0.37
122 0.44
123 0.42
124 0.41
125 0.4
126 0.4
127 0.42
128 0.38
129 0.33
130 0.25
131 0.28
132 0.28
133 0.27
134 0.25
135 0.23
136 0.26
137 0.29
138 0.29
139 0.3
140 0.32
141 0.36
142 0.43
143 0.48
144 0.53
145 0.6
146 0.68
147 0.71
148 0.74
149 0.78
150 0.82
151 0.84
152 0.81
153 0.76
154 0.69
155 0.62
156 0.54
157 0.46
158 0.35
159 0.26
160 0.2
161 0.16
162 0.12
163 0.08
164 0.06
165 0.05
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.08
174 0.13