Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5L0T2

Protein Details
Accession A0A5N5L0T2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-81VTYSHRCYKTPPSTRKFRKPSHERASCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 8, plas 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MEALARMLVGVLLGVVVVQFAVLHRLVCSRLSACCHVEQLPIRGGRCRLRGQRTVTYSHRCYKTPPSTRKFRKPSHERASC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.05
9 0.05
10 0.06
11 0.06
12 0.08
13 0.09
14 0.1
15 0.12
16 0.1
17 0.12
18 0.16
19 0.19
20 0.19
21 0.19
22 0.2
23 0.19
24 0.21
25 0.21
26 0.2
27 0.21
28 0.21
29 0.2
30 0.21
31 0.24
32 0.25
33 0.28
34 0.33
35 0.37
36 0.42
37 0.48
38 0.52
39 0.57
40 0.55
41 0.57
42 0.56
43 0.56
44 0.54
45 0.56
46 0.53
47 0.46
48 0.48
49 0.52
50 0.56
51 0.59
52 0.64
53 0.63
54 0.72
55 0.81
56 0.87
57 0.86
58 0.85
59 0.85
60 0.85
61 0.88