FuNGI

A0A5N5JE35

Protein Details

Accession

A0A5N5JE35

Localization Confidence

High

Confidence Score

22.2

NoLS Segment(s)

Position	Sequence	Protein Nature
14-37	MTPPAPAPKARRPVWKPPPRFAAR	Hydrophilic
125-144	NDKETPSKPQKPPSRPGKAT	Hydrophilic
389-409	GDPERCLSRRERQQNRFDERM	Hydrophilic

NLS Segment(s)

Position	Sequence
20-57	APKARRPVWKPPPRFAARGPQVVKRAMPPPPPPPQPKA
339-342	RRAR
353-359	RKARQRR

Subcellular Location(s)

nucl 20.5, cyto_nucl 13.5, cyto 5.5

Family & Domain DBs

Amino Acid Sequences

MPSPSQEARELQEMTPPAPAPKARRPVWKPPPRFAARGPQVVKRAMPPPPPPPQPKAPGFRQTPTPRAPLPPLQLSQAIEPVLPFFSTQDFMLSSQDIRDLQDTTETPSKLPGKGTSRTTAIRANDKETPSKPQKPPSRPGKATVQARVNVTTQHTTIPAVTFDRPQFPQPPRYVLRISQPPTPVCTPGASGNPSQLSQPQPRANRLNPVLSNPALAHVAGPSQRRLRSSPLAQQQDVTAAQSKPLTFENYRPTTASPAPIQPSPAQLIQAVEQDPLPKRDPSPKPETPKASASPKKGRFFTASNEQVQLAMEKSLRTHKEEQRKREAEQRALKLEEERRAREQRALMQEAERKARQRRRQEEEALMEPCWDMEDLWQECETDGETDSGDPERCLSRRERQQNRFDERMNEEVARIEAREAERERSMDFYNEHAADEVESRKEDALAEARYEAELRAEELQKEESKTEVLKNGDLKGTVKEDPYDLDADFEELLGAELDLVDVKSSTSPGDVKQGTMVFMASQETDYGDMDVTLEDLDDFL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.3
2	0.31
3	0.28
4	0.24
5	0.27
6	0.32
7	0.34
8	0.42
9	0.5
10	0.52
11	0.62
12	0.68
13	0.74
14	0.8
15	0.83
16	0.81
17	0.8
18	0.84
19	0.79
20	0.77
21	0.71
22	0.71
23	0.68
24	0.7
25	0.65
26	0.61
27	0.6
28	0.59
29	0.55
30	0.49
31	0.48
32	0.45
33	0.5
34	0.49
35	0.52
36	0.58
37	0.65
38	0.67
39	0.68
40	0.69
41	0.7
42	0.72
43	0.71
44	0.7
45	0.7
46	0.69
47	0.65
48	0.67
49	0.66
50	0.66
51	0.63
52	0.6
53	0.54
54	0.54
55	0.56
56	0.53
57	0.52
58	0.5
59	0.47
60	0.44
61	0.44
62	0.4
63	0.35
64	0.31
65	0.25
66	0.19
67	0.17
68	0.16
69	0.13
70	0.12
71	0.1
72	0.09
73	0.1
74	0.11
75	0.11
76	0.12
77	0.12
78	0.13
79	0.14
80	0.15
81	0.13
82	0.12
83	0.15
84	0.14
85	0.14
86	0.15
87	0.14
88	0.14
89	0.18
90	0.18
91	0.21
92	0.27
93	0.26
94	0.24
95	0.3
96	0.33
97	0.3
98	0.33
99	0.34
100	0.34
101	0.39
102	0.43
103	0.4
104	0.41
105	0.41
106	0.42
107	0.4
108	0.38
109	0.42
110	0.4
111	0.4
112	0.42
113	0.43
114	0.46
115	0.42
116	0.48
117	0.48
118	0.56
119	0.57
120	0.61
121	0.68
122	0.7
123	0.78
124	0.79
125	0.81
126	0.73
127	0.72
128	0.71
129	0.7
130	0.67
131	0.65
132	0.6
133	0.52
134	0.52
135	0.49
136	0.4
137	0.34
138	0.32
139	0.27
140	0.22
141	0.2
142	0.18
143	0.17
144	0.17
145	0.15
146	0.13
147	0.13
148	0.14
149	0.17
150	0.18
151	0.22
152	0.23
153	0.25
154	0.32
155	0.34
156	0.41
157	0.39
158	0.45
159	0.43
160	0.46
161	0.45
162	0.4
163	0.43
164	0.44
165	0.44
166	0.42
167	0.43
168	0.39
169	0.41
170	0.4
171	0.34
172	0.27
173	0.25
174	0.21
175	0.2
176	0.22
177	0.2
178	0.19
179	0.2
180	0.2
181	0.19
182	0.18
183	0.19
184	0.21
185	0.24
186	0.3
187	0.34
188	0.37
189	0.43
190	0.49
191	0.47
192	0.5
193	0.47
194	0.47
195	0.41
196	0.41
197	0.38
198	0.32
199	0.31
200	0.22
201	0.21
202	0.15
203	0.14
204	0.11
205	0.07
206	0.08
207	0.1
208	0.12
209	0.14
210	0.19
211	0.21
212	0.23
213	0.25
214	0.3
215	0.33
216	0.36
217	0.4
218	0.44
219	0.47
220	0.45
221	0.43
222	0.37
223	0.33
224	0.29
225	0.22
226	0.17
227	0.12
228	0.13
229	0.14
230	0.14
231	0.13
232	0.14
233	0.18
234	0.15
235	0.19
236	0.27
237	0.28
238	0.29
239	0.28
240	0.28
241	0.28
242	0.28
243	0.26
244	0.19
245	0.19
246	0.21
247	0.2
248	0.22
249	0.18
250	0.18
251	0.18
252	0.17
253	0.14
254	0.12
255	0.13
256	0.11
257	0.13
258	0.11
259	0.09
260	0.09
261	0.12
262	0.13
263	0.15
264	0.16
265	0.15
266	0.17
267	0.26
268	0.31
269	0.35
270	0.43
271	0.46
272	0.52
273	0.57
274	0.6
275	0.54
276	0.53
277	0.51
278	0.51
279	0.5
280	0.51
281	0.54
282	0.57
283	0.59
284	0.55
285	0.54
286	0.48
287	0.45
288	0.43
289	0.42
290	0.38
291	0.35
292	0.34
293	0.32
294	0.28
295	0.26
296	0.21
297	0.12
298	0.09
299	0.08
300	0.08
301	0.09
302	0.16
303	0.18
304	0.22
305	0.31
306	0.36
307	0.47
308	0.54
309	0.61
310	0.65
311	0.66
312	0.63
313	0.63
314	0.62
315	0.6
316	0.61
317	0.58
318	0.51
319	0.49
320	0.47
321	0.44
322	0.43
323	0.41
324	0.37
325	0.36
326	0.39
327	0.43
328	0.44
329	0.43
330	0.41
331	0.41
332	0.43
333	0.43
334	0.37
335	0.36
336	0.4
337	0.38
338	0.4
339	0.36
340	0.34
341	0.41
342	0.5
343	0.54
344	0.61
345	0.67
346	0.7
347	0.76
348	0.76
349	0.73
350	0.68
351	0.64
352	0.55
353	0.45
354	0.37
355	0.28
356	0.22
357	0.16
358	0.11
359	0.07
360	0.06
361	0.14
362	0.14
363	0.16
364	0.17
365	0.16
366	0.16
367	0.16
368	0.15
369	0.09
370	0.09
371	0.08
372	0.08
373	0.07
374	0.09
375	0.11
376	0.1
377	0.09
378	0.1
379	0.14
380	0.15
381	0.18
382	0.23
383	0.3
384	0.4
385	0.51
386	0.6
387	0.65
388	0.74
389	0.81
390	0.84
391	0.8
392	0.72
393	0.68
394	0.61
395	0.56
396	0.49
397	0.39
398	0.31
399	0.27
400	0.25
401	0.2
402	0.15
403	0.12
404	0.13
405	0.14
406	0.2
407	0.22
408	0.24
409	0.26
410	0.27
411	0.27
412	0.26
413	0.27
414	0.23
415	0.22
416	0.21
417	0.24
418	0.24
419	0.23
420	0.2
421	0.19
422	0.17
423	0.18
424	0.18
425	0.14
426	0.14
427	0.15
428	0.14
429	0.15
430	0.14
431	0.15
432	0.18
433	0.18
434	0.18
435	0.18
436	0.18
437	0.18
438	0.18
439	0.15
440	0.11
441	0.1
442	0.11
443	0.15
444	0.17
445	0.18
446	0.19
447	0.24
448	0.25
449	0.27
450	0.26
451	0.22
452	0.22
453	0.24
454	0.26
455	0.28
456	0.27
457	0.3
458	0.32
459	0.34
460	0.33
461	0.32
462	0.3
463	0.27
464	0.29
465	0.27
466	0.26
467	0.24
468	0.23
469	0.24
470	0.25
471	0.23
472	0.18
473	0.17
474	0.16
475	0.16
476	0.15
477	0.12
478	0.09
479	0.07
480	0.08
481	0.06
482	0.06
483	0.04
484	0.04
485	0.04
486	0.05
487	0.05
488	0.05
489	0.05
490	0.06
491	0.07
492	0.08
493	0.08
494	0.11
495	0.13
496	0.14
497	0.24
498	0.24
499	0.24
500	0.28
501	0.28
502	0.26
503	0.25
504	0.23
505	0.14
506	0.14
507	0.15
508	0.11
509	0.11
510	0.1
511	0.1
512	0.11
513	0.11
514	0.11
515	0.1
516	0.09
517	0.09
518	0.09
519	0.08
520	0.07
521	0.06

A0A5N5JE35

3D AlphaFold-predicted Structure Viewer