Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5PNX3

Protein Details
Accession A0A5N5PNX3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39SHAHNTSKPAAKRKRENRYKNAPPAVLHydrophilic
NLS Segment(s)
PositionSequence
20-43KPAAKRKRENRYKNAPPAVLSRRR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences YPSPERHVKEGESHAHNTSKPAAKRKRENRYKNAPPAVLSRRRAQTEASQRAYRERKEQRIKVLEAMLKDATQRHNVLRQAYAILRAEYVRLKTSQRNEQQPYTTYSGADLVSDPIMGTMTGADGDSLDMCLFFSSGLTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.43
4 0.39
5 0.39
6 0.39
7 0.4
8 0.47
9 0.54
10 0.6
11 0.7
12 0.78
13 0.82
14 0.85
15 0.89
16 0.89
17 0.9
18 0.9
19 0.89
20 0.85
21 0.75
22 0.66
23 0.64
24 0.63
25 0.6
26 0.53
27 0.5
28 0.49
29 0.5
30 0.49
31 0.44
32 0.44
33 0.47
34 0.52
35 0.5
36 0.47
37 0.45
38 0.52
39 0.55
40 0.48
41 0.47
42 0.47
43 0.53
44 0.6
45 0.64
46 0.64
47 0.65
48 0.64
49 0.56
50 0.52
51 0.43
52 0.34
53 0.32
54 0.23
55 0.17
56 0.16
57 0.16
58 0.14
59 0.14
60 0.16
61 0.15
62 0.2
63 0.22
64 0.23
65 0.22
66 0.2
67 0.2
68 0.19
69 0.2
70 0.16
71 0.13
72 0.12
73 0.11
74 0.12
75 0.13
76 0.14
77 0.13
78 0.14
79 0.17
80 0.22
81 0.29
82 0.37
83 0.42
84 0.5
85 0.53
86 0.55
87 0.56
88 0.52
89 0.51
90 0.46
91 0.39
92 0.3
93 0.26
94 0.23
95 0.19
96 0.18
97 0.13
98 0.09
99 0.09
100 0.09
101 0.08
102 0.06
103 0.07
104 0.06
105 0.05
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.04
112 0.05
113 0.05
114 0.06
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05