Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M8G1

Protein Details
Accession C5M8G1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-106MKPGDKPKPPIRGPPPKRKRVBasic
NLS Segment(s)
PositionSequence
88-106PGDKPKPPIRGPPPKRKRV
Subcellular Location(s) cyto_nucl 12.666, nucl 11.5, cyto 10.5, cyto_mito 8.332, mito_nucl 8.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034099  SmD3  
Gene Ontology GO:0000243  C:commitment complex  
GO:0005829  C:cytosol  
GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003729  F:mRNA binding  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0000387  P:spliceosomal snRNP assembly  
KEGG ctp:CTRG_02683  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01721  Sm_D3  
Amino Acid Sequences MSAGIPVRLLNEAQGHVISIELTNGDTYRGKLLENEDNMNLSLYEATVTKGKSGSVEHMDQVFIRGSMIRFVSVPDILKNAPMFFMKPGDKPKPPIRGPPPKRKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.12
5 0.1
6 0.07
7 0.06
8 0.05
9 0.06
10 0.06
11 0.06
12 0.08
13 0.09
14 0.1
15 0.12
16 0.12
17 0.12
18 0.14
19 0.18
20 0.23
21 0.24
22 0.25
23 0.23
24 0.23
25 0.23
26 0.21
27 0.17
28 0.1
29 0.08
30 0.05
31 0.06
32 0.05
33 0.06
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.12
42 0.14
43 0.14
44 0.15
45 0.15
46 0.15
47 0.13
48 0.14
49 0.11
50 0.07
51 0.07
52 0.07
53 0.07
54 0.09
55 0.1
56 0.09
57 0.09
58 0.09
59 0.11
60 0.12
61 0.12
62 0.11
63 0.13
64 0.12
65 0.15
66 0.15
67 0.13
68 0.13
69 0.13
70 0.14
71 0.13
72 0.19
73 0.19
74 0.24
75 0.33
76 0.39
77 0.43
78 0.49
79 0.56
80 0.6
81 0.62
82 0.67
83 0.69
84 0.73
85 0.78
86 0.81