Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MWT8

Protein Details
Accession A0A5N5MWT8    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSNKTFKTKQKLAKAQKQNRPIPQWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSNKTFKTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRNWRKTSLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.86
5 0.87
6 0.83
7 0.8
8 0.75
9 0.72
10 0.66
11 0.64
12 0.64
13 0.57
14 0.55
15 0.5
16 0.47
17 0.45
18 0.47
19 0.47
20 0.42
21 0.44
22 0.45
23 0.51
24 0.57
25 0.6
26 0.62
27 0.65
28 0.71
29 0.77
30 0.78
31 0.77