Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5K8Z8

Protein Details
Accession A0A5N5K8Z8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
124-151IRLSLPAARRRSRRRPPIRDPRSRAAGLHydrophilic
NLS Segment(s)
PositionSequence
130-147AARRRSRRRPPIRDPRSR
Subcellular Location(s) mito 10, nucl 5, cyto 3, plas 3, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MSSPSFAVYTAEAQQLRRNKTLTSLSAPNTQTSPYILKRKHPSLLFPSLPHHLPLLLPPPLNLPAPEYLLLLGLLPLPVLPLLPVSPSHLPLISHLLLPFVPYSLLPLPHRPVLLPHPQPPLPIRLSLPAARRRSRRRPPIRDPRSRAAGLGHEGVFPQRLDGEGPEEREGRAEGVVGAGVRWWGWGTTWGRCWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.39
4 0.41
5 0.4
6 0.35
7 0.4
8 0.45
9 0.43
10 0.42
11 0.42
12 0.4
13 0.46
14 0.47
15 0.42
16 0.36
17 0.32
18 0.27
19 0.24
20 0.27
21 0.26
22 0.34
23 0.35
24 0.43
25 0.51
26 0.56
27 0.6
28 0.56
29 0.56
30 0.54
31 0.6
32 0.53
33 0.47
34 0.45
35 0.41
36 0.4
37 0.33
38 0.26
39 0.18
40 0.16
41 0.17
42 0.18
43 0.17
44 0.17
45 0.16
46 0.18
47 0.2
48 0.2
49 0.18
50 0.15
51 0.13
52 0.15
53 0.15
54 0.13
55 0.11
56 0.1
57 0.1
58 0.08
59 0.06
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.05
72 0.08
73 0.09
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.16
80 0.13
81 0.13
82 0.12
83 0.12
84 0.11
85 0.11
86 0.1
87 0.05
88 0.05
89 0.04
90 0.07
91 0.08
92 0.11
93 0.11
94 0.14
95 0.17
96 0.18
97 0.18
98 0.16
99 0.17
100 0.2
101 0.28
102 0.29
103 0.31
104 0.34
105 0.34
106 0.36
107 0.35
108 0.35
109 0.27
110 0.25
111 0.22
112 0.2
113 0.23
114 0.25
115 0.31
116 0.34
117 0.39
118 0.44
119 0.52
120 0.59
121 0.66
122 0.73
123 0.77
124 0.8
125 0.84
126 0.88
127 0.91
128 0.92
129 0.92
130 0.89
131 0.85
132 0.81
133 0.71
134 0.61
135 0.52
136 0.45
137 0.37
138 0.33
139 0.26
140 0.19
141 0.19
142 0.19
143 0.18
144 0.14
145 0.12
146 0.09
147 0.09
148 0.1
149 0.11
150 0.15
151 0.17
152 0.2
153 0.22
154 0.23
155 0.22
156 0.23
157 0.22
158 0.18
159 0.15
160 0.12
161 0.09
162 0.09
163 0.1
164 0.08
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.06
172 0.07
173 0.15
174 0.18
175 0.24