Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5PP47

Protein Details
Accession A0A5N5PP47    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-99FPPFTSRKQIWRRCGRGERKGTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008386  ATP_synth_F0_esu_mt  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF05680  ATP-synt_E  
Amino Acid Sequences MSATSGVNVLRYSALAVGVAYGFYHQRTITQHVRSQQAEREYKHKEQLINQAKAEFAKSKQPAVSKVAEKVAGGREFPPFTSRKQIWRRCGRGERKGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.07
5 0.06
6 0.06
7 0.05
8 0.05
9 0.06
10 0.06
11 0.08
12 0.08
13 0.11
14 0.14
15 0.21
16 0.27
17 0.31
18 0.34
19 0.37
20 0.43
21 0.42
22 0.41
23 0.39
24 0.4
25 0.41
26 0.39
27 0.41
28 0.41
29 0.42
30 0.45
31 0.43
32 0.37
33 0.36
34 0.45
35 0.48
36 0.45
37 0.42
38 0.37
39 0.34
40 0.32
41 0.3
42 0.21
43 0.13
44 0.19
45 0.2
46 0.22
47 0.25
48 0.27
49 0.28
50 0.3
51 0.34
52 0.28
53 0.29
54 0.29
55 0.27
56 0.25
57 0.24
58 0.26
59 0.22
60 0.21
61 0.19
62 0.21
63 0.21
64 0.22
65 0.24
66 0.2
67 0.22
68 0.31
69 0.33
70 0.39
71 0.49
72 0.58
73 0.64
74 0.73
75 0.77
76 0.78
77 0.85
78 0.85
79 0.85