Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LDZ7

Protein Details
Accession A0A5N5LDZ7    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
272-296AVLPPPPAPRRRRARSVRRVRSADDHydrophilic
315-335GPAAPGGRRNPPRKAKRSALEHydrophilic
NLS Segment(s)
PositionSequence
276-291PPPAPRRRRARSVRRV
319-332PGGRRNPPRKAKRS
Subcellular Location(s) nucl 16, pero 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MMDEPDWAWPPPPDDINNDQVDGAAAARLGRPFVQPYAWPWAFPGHRPIPEIPNFEPPAFRYHPQILPYNDLPRRQVRSRPDVVNLVSDVPPRNNNAIPELPNYRLPVFPGGPAHARYGNVPQAPRSIFGPHPVAQAPANTPNNNPGAPGLIFGPPPQAPQRRTCCSEGNDAWFDGINETGPRSDGQGPGPSEEQDDLPRAPQHRNSPVYRAALRELHNAQLALRVINLREQEERRNALRFFLDPAPEAAEPPSPPPRVHPQFGGLRLPAPAVLPPPPAPRRRRARSVRRVRSADDAPVVAAAAAARAENDEDAGPAAPGGRRNPPRKAKRSALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.4
5 0.38
6 0.33
7 0.29
8 0.27
9 0.2
10 0.15
11 0.09
12 0.07
13 0.07
14 0.09
15 0.09
16 0.1
17 0.12
18 0.14
19 0.17
20 0.19
21 0.21
22 0.2
23 0.24
24 0.33
25 0.31
26 0.29
27 0.27
28 0.33
29 0.32
30 0.33
31 0.38
32 0.35
33 0.37
34 0.41
35 0.43
36 0.43
37 0.48
38 0.51
39 0.45
40 0.47
41 0.47
42 0.44
43 0.42
44 0.35
45 0.36
46 0.35
47 0.33
48 0.3
49 0.33
50 0.37
51 0.38
52 0.44
53 0.39
54 0.41
55 0.44
56 0.47
57 0.45
58 0.44
59 0.45
60 0.45
61 0.5
62 0.48
63 0.52
64 0.51
65 0.56
66 0.6
67 0.59
68 0.56
69 0.54
70 0.5
71 0.45
72 0.37
73 0.31
74 0.25
75 0.24
76 0.22
77 0.2
78 0.21
79 0.21
80 0.24
81 0.23
82 0.23
83 0.26
84 0.27
85 0.27
86 0.29
87 0.29
88 0.28
89 0.28
90 0.3
91 0.26
92 0.23
93 0.22
94 0.23
95 0.2
96 0.2
97 0.19
98 0.19
99 0.2
100 0.21
101 0.22
102 0.19
103 0.18
104 0.18
105 0.21
106 0.24
107 0.24
108 0.23
109 0.22
110 0.25
111 0.25
112 0.24
113 0.21
114 0.2
115 0.18
116 0.21
117 0.24
118 0.21
119 0.22
120 0.22
121 0.21
122 0.18
123 0.19
124 0.17
125 0.2
126 0.23
127 0.21
128 0.21
129 0.24
130 0.25
131 0.24
132 0.22
133 0.14
134 0.13
135 0.12
136 0.12
137 0.1
138 0.09
139 0.09
140 0.09
141 0.12
142 0.1
143 0.12
144 0.17
145 0.22
146 0.23
147 0.31
148 0.38
149 0.4
150 0.44
151 0.45
152 0.44
153 0.41
154 0.45
155 0.39
156 0.36
157 0.32
158 0.28
159 0.25
160 0.2
161 0.17
162 0.11
163 0.09
164 0.06
165 0.05
166 0.05
167 0.05
168 0.06
169 0.06
170 0.09
171 0.11
172 0.12
173 0.13
174 0.18
175 0.19
176 0.2
177 0.2
178 0.18
179 0.17
180 0.16
181 0.15
182 0.11
183 0.13
184 0.11
185 0.13
186 0.15
187 0.16
188 0.19
189 0.23
190 0.29
191 0.35
192 0.4
193 0.4
194 0.42
195 0.45
196 0.46
197 0.43
198 0.37
199 0.33
200 0.32
201 0.32
202 0.33
203 0.29
204 0.27
205 0.27
206 0.25
207 0.21
208 0.2
209 0.19
210 0.13
211 0.13
212 0.11
213 0.11
214 0.14
215 0.15
216 0.14
217 0.19
218 0.21
219 0.27
220 0.32
221 0.36
222 0.34
223 0.38
224 0.36
225 0.33
226 0.33
227 0.27
228 0.27
229 0.26
230 0.25
231 0.2
232 0.21
233 0.22
234 0.2
235 0.2
236 0.17
237 0.15
238 0.14
239 0.18
240 0.25
241 0.23
242 0.23
243 0.28
244 0.38
245 0.41
246 0.44
247 0.41
248 0.4
249 0.45
250 0.48
251 0.47
252 0.37
253 0.31
254 0.29
255 0.27
256 0.21
257 0.15
258 0.13
259 0.11
260 0.13
261 0.15
262 0.18
263 0.27
264 0.34
265 0.42
266 0.47
267 0.54
268 0.63
269 0.68
270 0.76
271 0.78
272 0.82
273 0.84
274 0.9
275 0.91
276 0.9
277 0.86
278 0.79
279 0.76
280 0.68
281 0.62
282 0.53
283 0.43
284 0.33
285 0.28
286 0.25
287 0.17
288 0.13
289 0.08
290 0.05
291 0.05
292 0.05
293 0.05
294 0.06
295 0.07
296 0.07
297 0.09
298 0.08
299 0.08
300 0.1
301 0.1
302 0.09
303 0.08
304 0.1
305 0.11
306 0.15
307 0.19
308 0.28
309 0.37
310 0.44
311 0.55
312 0.64
313 0.73
314 0.78
315 0.83