Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5P936

Protein Details
Accession A0A5N5P936    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
344-366NNIIKPLLKKLRKCRDPDRFNLVHydrophilic
NLS Segment(s)
PositionSequence
417-427EGRDVKRRKTE
Subcellular Location(s) nucl 13, mito_nucl 10.333, cyto_nucl 9.333, mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
IPR031658  Cyclin_C_2  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF16899  Cyclin_C_2  
CDD cd20524  CYCLIN_CCNH_rpt1  
cd20525  CYCLIN_CCNH_rpt2  
Amino Acid Sequences MAAEDVRYRQSTQYRLWSFSPVQLASTREQTNALARSNISERLLSNPPPPPPAASLKPPPATGASDATSGSNTPDPHAAAQQHQQQQAEQPYTLPEFLTPAEELQLLNYYTVELLRAANHFNLRSPMLASAAVFLRRFYATNSVMTYPPAEMLKTCLFFGCKAEGYYPNNEQFAQQFPKTKGEGILAGEFLLCQGIRFAFDVKHPFRGLEGAVLELRRYGDVDSTRINDASNRAKEILRFSPLVTDAYFHYTPSQIMLAALSLADQDLADRVLHETFHRHPQTEQKSNKSSNSSTSASTSEQRAALISSEVRARVAEAVNACRDLLAKEPPERLTSYWDTPESNNIIKPLLKKLRKCRDPDRFNLVELQKAKREEALRREEAEEKRAAGGGDKKTVEADGSVFGEALGGAGGGRGGEGRDVKRRKTEGKGGDPFGGPLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.54
4 0.54
5 0.49
6 0.47
7 0.47
8 0.37
9 0.35
10 0.34
11 0.35
12 0.31
13 0.36
14 0.33
15 0.27
16 0.29
17 0.28
18 0.32
19 0.33
20 0.32
21 0.27
22 0.25
23 0.29
24 0.31
25 0.33
26 0.27
27 0.25
28 0.23
29 0.27
30 0.32
31 0.31
32 0.34
33 0.35
34 0.37
35 0.38
36 0.39
37 0.36
38 0.35
39 0.4
40 0.38
41 0.4
42 0.45
43 0.5
44 0.51
45 0.49
46 0.46
47 0.41
48 0.39
49 0.34
50 0.3
51 0.23
52 0.22
53 0.22
54 0.2
55 0.18
56 0.15
57 0.15
58 0.15
59 0.14
60 0.15
61 0.17
62 0.18
63 0.19
64 0.24
65 0.23
66 0.23
67 0.3
68 0.37
69 0.41
70 0.43
71 0.42
72 0.38
73 0.43
74 0.46
75 0.42
76 0.33
77 0.27
78 0.27
79 0.28
80 0.27
81 0.2
82 0.14
83 0.13
84 0.13
85 0.15
86 0.12
87 0.1
88 0.11
89 0.11
90 0.11
91 0.1
92 0.13
93 0.1
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.08
100 0.06
101 0.07
102 0.08
103 0.1
104 0.11
105 0.13
106 0.17
107 0.16
108 0.17
109 0.2
110 0.19
111 0.18
112 0.17
113 0.15
114 0.14
115 0.14
116 0.12
117 0.11
118 0.12
119 0.14
120 0.13
121 0.12
122 0.13
123 0.13
124 0.14
125 0.14
126 0.19
127 0.18
128 0.2
129 0.22
130 0.22
131 0.22
132 0.22
133 0.21
134 0.14
135 0.14
136 0.12
137 0.1
138 0.08
139 0.13
140 0.15
141 0.15
142 0.15
143 0.15
144 0.15
145 0.16
146 0.18
147 0.16
148 0.14
149 0.14
150 0.16
151 0.2
152 0.22
153 0.26
154 0.28
155 0.27
156 0.27
157 0.27
158 0.25
159 0.21
160 0.24
161 0.24
162 0.22
163 0.25
164 0.26
165 0.31
166 0.31
167 0.31
168 0.26
169 0.23
170 0.23
171 0.19
172 0.17
173 0.13
174 0.12
175 0.11
176 0.09
177 0.08
178 0.06
179 0.04
180 0.03
181 0.04
182 0.04
183 0.05
184 0.06
185 0.07
186 0.07
187 0.1
188 0.18
189 0.19
190 0.23
191 0.22
192 0.22
193 0.21
194 0.21
195 0.19
196 0.13
197 0.12
198 0.09
199 0.09
200 0.09
201 0.09
202 0.08
203 0.08
204 0.06
205 0.07
206 0.06
207 0.08
208 0.09
209 0.11
210 0.12
211 0.14
212 0.14
213 0.14
214 0.14
215 0.12
216 0.15
217 0.21
218 0.21
219 0.2
220 0.21
221 0.22
222 0.23
223 0.27
224 0.25
225 0.21
226 0.2
227 0.19
228 0.2
229 0.2
230 0.2
231 0.15
232 0.13
233 0.11
234 0.16
235 0.16
236 0.14
237 0.14
238 0.13
239 0.13
240 0.13
241 0.13
242 0.07
243 0.07
244 0.06
245 0.05
246 0.05
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.04
256 0.04
257 0.04
258 0.06
259 0.06
260 0.07
261 0.08
262 0.12
263 0.14
264 0.24
265 0.25
266 0.25
267 0.27
268 0.36
269 0.45
270 0.5
271 0.54
272 0.52
273 0.57
274 0.6
275 0.62
276 0.58
277 0.5
278 0.45
279 0.45
280 0.39
281 0.33
282 0.31
283 0.29
284 0.26
285 0.26
286 0.24
287 0.2
288 0.19
289 0.18
290 0.16
291 0.14
292 0.13
293 0.12
294 0.1
295 0.09
296 0.11
297 0.11
298 0.11
299 0.1
300 0.1
301 0.12
302 0.12
303 0.14
304 0.14
305 0.17
306 0.18
307 0.19
308 0.18
309 0.15
310 0.15
311 0.13
312 0.14
313 0.17
314 0.2
315 0.24
316 0.28
317 0.29
318 0.31
319 0.32
320 0.3
321 0.31
322 0.32
323 0.32
324 0.32
325 0.32
326 0.31
327 0.3
328 0.34
329 0.31
330 0.29
331 0.26
332 0.24
333 0.24
334 0.25
335 0.27
336 0.32
337 0.38
338 0.43
339 0.5
340 0.6
341 0.69
342 0.74
343 0.79
344 0.8
345 0.81
346 0.82
347 0.81
348 0.79
349 0.7
350 0.63
351 0.64
352 0.54
353 0.5
354 0.46
355 0.43
356 0.39
357 0.4
358 0.39
359 0.37
360 0.42
361 0.43
362 0.48
363 0.52
364 0.51
365 0.52
366 0.55
367 0.56
368 0.54
369 0.51
370 0.44
371 0.36
372 0.33
373 0.31
374 0.28
375 0.25
376 0.3
377 0.29
378 0.33
379 0.32
380 0.32
381 0.31
382 0.31
383 0.26
384 0.2
385 0.17
386 0.13
387 0.14
388 0.13
389 0.12
390 0.11
391 0.11
392 0.09
393 0.08
394 0.05
395 0.03
396 0.03
397 0.03
398 0.03
399 0.03
400 0.03
401 0.04
402 0.05
403 0.09
404 0.15
405 0.2
406 0.3
407 0.36
408 0.42
409 0.51
410 0.58
411 0.62
412 0.66
413 0.71
414 0.71
415 0.75
416 0.78
417 0.73
418 0.7
419 0.63