Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5K8Z0

Protein Details
Accession A0A5N5K8Z0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-84AKCTGNSKSKRPHDRRNKAGEMRRVSHydrophilic
NLS Segment(s)
PositionSequence
68-74KRPHDRR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MTPSKSTLSFSRCLFLLCLWATASMSRQSPLPIVKGICCIRCLARHQGRQREPENDMMAKCTGNSKSKRPHDRRNKAGEMRRVSNSVKVLVLVDYQAECKRLVSQTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.21
3 0.22
4 0.18
5 0.18
6 0.16
7 0.16
8 0.15
9 0.15
10 0.17
11 0.14
12 0.14
13 0.13
14 0.14
15 0.14
16 0.17
17 0.18
18 0.18
19 0.18
20 0.18
21 0.18
22 0.24
23 0.26
24 0.24
25 0.22
26 0.22
27 0.21
28 0.23
29 0.27
30 0.3
31 0.36
32 0.43
33 0.5
34 0.59
35 0.62
36 0.65
37 0.64
38 0.58
39 0.51
40 0.47
41 0.43
42 0.35
43 0.29
44 0.25
45 0.22
46 0.17
47 0.16
48 0.15
49 0.16
50 0.21
51 0.25
52 0.31
53 0.4
54 0.5
55 0.61
56 0.66
57 0.73
58 0.77
59 0.84
60 0.86
61 0.85
62 0.85
63 0.82
64 0.82
65 0.8
66 0.75
67 0.7
68 0.63
69 0.58
70 0.5
71 0.47
72 0.41
73 0.34
74 0.27
75 0.23
76 0.21
77 0.18
78 0.17
79 0.12
80 0.11
81 0.1
82 0.13
83 0.14
84 0.15
85 0.14
86 0.15
87 0.19