Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5L1D5

Protein Details
Accession A0A5N5L1D5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGTRRRPHRCHQPWKRNRDQQYNRHHPEQABasic
459-479GLSERDRRMMREKKNAEKDAEBasic
NLS Segment(s)
PositionSequence
465-486RRMMREKKNAEKDAEKKAGAKK
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MGTRRRPHRCHQPWKRNRDQQYNRHHPEQAHQHPNRQQGHAQDSGQAYPHLNGQQGYGPSPAHHLPPYQPTHVPHAGQPQYHQHSHGLAGNQPFLPGHTLLQMNPPGQGWLLHPHPPVPGMAVHQHITPGWPHPAPVQNQQAYHPNGFHQIPAHNAYPAPGAAMASPAPGMLQAQAWQPIHSTQASQYRHQHHYNPPATQAYAGPMHMPPPGPFQQTGGFHPGPPAQYRQPYTPYPQDQPCQPAPPASWPQAYHTLAAHPQPGFQVQHQPNPQPQQSWHFGPPMPYVPVHPTAFAPLQPPYQHQLDPQAQPWHRGPPMPTVPDYHPTAGPSQPQPQPQSQHHLDPQAQPWHPGAHMPSIPAYHTTAVLRQPLQHSRIQQQPGPPVQQWLHRPPPPLPVPLGMPPVPHHWQFPLPPAPPVAIGATLPPKDTRDRRPSAPATAPPPPPTSPPPRAPPVVCGLSERDRRMMREKKNAEKDAEKKAGAKKDGEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.93
4 0.92
5 0.92
6 0.91
7 0.9
8 0.91
9 0.91
10 0.88
11 0.84
12 0.78
13 0.69
14 0.68
15 0.69
16 0.68
17 0.68
18 0.65
19 0.68
20 0.69
21 0.77
22 0.73
23 0.66
24 0.6
25 0.57
26 0.59
27 0.55
28 0.49
29 0.45
30 0.41
31 0.38
32 0.36
33 0.29
34 0.25
35 0.2
36 0.24
37 0.21
38 0.21
39 0.2
40 0.2
41 0.24
42 0.24
43 0.25
44 0.22
45 0.2
46 0.19
47 0.23
48 0.23
49 0.22
50 0.23
51 0.23
52 0.25
53 0.34
54 0.39
55 0.38
56 0.41
57 0.4
58 0.46
59 0.48
60 0.45
61 0.4
62 0.45
63 0.44
64 0.41
65 0.42
66 0.44
67 0.45
68 0.46
69 0.44
70 0.36
71 0.33
72 0.35
73 0.35
74 0.27
75 0.25
76 0.26
77 0.26
78 0.24
79 0.23
80 0.2
81 0.17
82 0.18
83 0.15
84 0.13
85 0.14
86 0.15
87 0.16
88 0.22
89 0.24
90 0.22
91 0.21
92 0.21
93 0.18
94 0.17
95 0.17
96 0.14
97 0.16
98 0.19
99 0.23
100 0.23
101 0.24
102 0.24
103 0.24
104 0.22
105 0.18
106 0.16
107 0.14
108 0.16
109 0.18
110 0.18
111 0.17
112 0.18
113 0.16
114 0.16
115 0.15
116 0.15
117 0.17
118 0.16
119 0.16
120 0.2
121 0.26
122 0.29
123 0.35
124 0.41
125 0.39
126 0.4
127 0.42
128 0.45
129 0.43
130 0.41
131 0.33
132 0.26
133 0.28
134 0.27
135 0.26
136 0.2
137 0.18
138 0.2
139 0.23
140 0.23
141 0.18
142 0.18
143 0.18
144 0.16
145 0.15
146 0.12
147 0.08
148 0.07
149 0.07
150 0.08
151 0.07
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.05
160 0.06
161 0.07
162 0.13
163 0.13
164 0.13
165 0.14
166 0.14
167 0.16
168 0.15
169 0.14
170 0.13
171 0.22
172 0.24
173 0.28
174 0.35
175 0.4
176 0.45
177 0.47
178 0.5
179 0.49
180 0.57
181 0.56
182 0.5
183 0.46
184 0.42
185 0.39
186 0.33
187 0.25
188 0.18
189 0.14
190 0.13
191 0.12
192 0.1
193 0.11
194 0.11
195 0.12
196 0.1
197 0.15
198 0.18
199 0.19
200 0.19
201 0.19
202 0.23
203 0.24
204 0.25
205 0.26
206 0.23
207 0.22
208 0.23
209 0.23
210 0.2
211 0.2
212 0.22
213 0.18
214 0.23
215 0.25
216 0.26
217 0.29
218 0.29
219 0.33
220 0.36
221 0.36
222 0.37
223 0.38
224 0.37
225 0.35
226 0.38
227 0.35
228 0.31
229 0.27
230 0.24
231 0.21
232 0.25
233 0.27
234 0.24
235 0.25
236 0.22
237 0.25
238 0.3
239 0.3
240 0.25
241 0.22
242 0.2
243 0.2
244 0.2
245 0.2
246 0.13
247 0.12
248 0.12
249 0.14
250 0.14
251 0.13
252 0.22
253 0.21
254 0.28
255 0.31
256 0.33
257 0.35
258 0.39
259 0.4
260 0.31
261 0.31
262 0.3
263 0.32
264 0.33
265 0.31
266 0.28
267 0.27
268 0.28
269 0.28
270 0.25
271 0.22
272 0.19
273 0.18
274 0.19
275 0.23
276 0.2
277 0.19
278 0.16
279 0.18
280 0.18
281 0.18
282 0.16
283 0.13
284 0.16
285 0.16
286 0.18
287 0.19
288 0.21
289 0.2
290 0.19
291 0.26
292 0.28
293 0.29
294 0.32
295 0.37
296 0.35
297 0.38
298 0.39
299 0.37
300 0.33
301 0.33
302 0.31
303 0.31
304 0.37
305 0.36
306 0.35
307 0.32
308 0.34
309 0.36
310 0.37
311 0.29
312 0.24
313 0.23
314 0.24
315 0.22
316 0.23
317 0.23
318 0.27
319 0.29
320 0.34
321 0.37
322 0.39
323 0.44
324 0.43
325 0.48
326 0.44
327 0.46
328 0.44
329 0.45
330 0.43
331 0.41
332 0.44
333 0.44
334 0.41
335 0.37
336 0.36
337 0.32
338 0.29
339 0.27
340 0.23
341 0.2
342 0.2
343 0.19
344 0.19
345 0.18
346 0.19
347 0.18
348 0.18
349 0.13
350 0.14
351 0.14
352 0.16
353 0.18
354 0.22
355 0.21
356 0.22
357 0.27
358 0.32
359 0.35
360 0.36
361 0.37
362 0.4
363 0.47
364 0.48
365 0.45
366 0.44
367 0.48
368 0.5
369 0.5
370 0.44
371 0.42
372 0.4
373 0.44
374 0.45
375 0.46
376 0.49
377 0.48
378 0.52
379 0.48
380 0.55
381 0.53
382 0.49
383 0.42
384 0.36
385 0.35
386 0.35
387 0.38
388 0.29
389 0.27
390 0.26
391 0.3
392 0.32
393 0.3
394 0.28
395 0.26
396 0.3
397 0.31
398 0.36
399 0.38
400 0.35
401 0.36
402 0.35
403 0.33
404 0.29
405 0.28
406 0.21
407 0.14
408 0.12
409 0.14
410 0.19
411 0.18
412 0.19
413 0.2
414 0.22
415 0.3
416 0.38
417 0.45
418 0.49
419 0.55
420 0.58
421 0.66
422 0.68
423 0.66
424 0.66
425 0.62
426 0.58
427 0.6
428 0.59
429 0.53
430 0.53
431 0.48
432 0.46
433 0.48
434 0.51
435 0.51
436 0.54
437 0.58
438 0.6
439 0.65
440 0.61
441 0.57
442 0.56
443 0.51
444 0.44
445 0.4
446 0.39
447 0.42
448 0.47
449 0.46
450 0.46
451 0.46
452 0.5
453 0.58
454 0.62
455 0.62
456 0.66
457 0.72
458 0.75
459 0.82
460 0.83
461 0.8
462 0.8
463 0.77
464 0.76
465 0.74
466 0.65
467 0.61
468 0.63
469 0.65
470 0.6
471 0.57