FuNGI

A0A5N5L1D5

Protein Details

Accession

A0A5N5L1D5

Localization Confidence

Medium

Confidence Score

13.7

NoLS Segment(s)

Position	Sequence	Protein Nature
1-30	MGTRRRPHRCHQPWKRNRDQQYNRHHPEQA	Basic
459-479	GLSERDRRMMREKKNAEKDAE	Basic

NLS Segment(s)

Position	Sequence
465-486	RRMMREKKNAEKDAEKKAGAKK

Subcellular Location(s)

mito 12, nucl 10, cyto 5

Family & Domain DBs

Amino Acid Sequences

MGTRRRPHRCHQPWKRNRDQQYNRHHPEQAHQHPNRQQGHAQDSGQAYPHLNGQQGYGPSPAHHLPPYQPTHVPHAGQPQYHQHSHGLAGNQPFLPGHTLLQMNPPGQGWLLHPHPPVPGMAVHQHITPGWPHPAPVQNQQAYHPNGFHQIPAHNAYPAPGAAMASPAPGMLQAQAWQPIHSTQASQYRHQHHYNPPATQAYAGPMHMPPPGPFQQTGGFHPGPPAQYRQPYTPYPQDQPCQPAPPASWPQAYHTLAAHPQPGFQVQHQPNPQPQQSWHFGPPMPYVPVHPTAFAPLQPPYQHQLDPQAQPWHRGPPMPTVPDYHPTAGPSQPQPQPQSQHHLDPQAQPWHPGAHMPSIPAYHTTAVLRQPLQHSRIQQQPGPPVQQWLHRPPPPLPVPLGMPPVPHHWQFPLPPAPPVAIGATLPPKDTRDRRPSAPATAPPPPPTSPPPRAPPVVCGLSERDRRMMREKKNAEKDAEKKAGAKKDGEEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.93
2	0.95
3	0.93
4	0.92
5	0.92
6	0.91
7	0.9
8	0.91
9	0.91
10	0.88
11	0.84
12	0.78
13	0.69
14	0.68
15	0.69
16	0.68
17	0.68
18	0.65
19	0.68
20	0.69
21	0.77
22	0.73
23	0.66
24	0.6
25	0.57
26	0.59
27	0.55
28	0.49
29	0.45
30	0.41
31	0.38
32	0.36
33	0.29
34	0.25
35	0.2
36	0.24
37	0.21
38	0.21
39	0.2
40	0.2
41	0.24
42	0.24
43	0.25
44	0.22
45	0.2
46	0.19
47	0.23
48	0.23
49	0.22
50	0.23
51	0.23
52	0.25
53	0.34
54	0.39
55	0.38
56	0.41
57	0.4
58	0.46
59	0.48
60	0.45
61	0.4
62	0.45
63	0.44
64	0.41
65	0.42
66	0.44
67	0.45
68	0.46
69	0.44
70	0.36
71	0.33
72	0.35
73	0.35
74	0.27
75	0.25
76	0.26
77	0.26
78	0.24
79	0.23
80	0.2
81	0.17
82	0.18
83	0.15
84	0.13
85	0.14
86	0.15
87	0.16
88	0.22
89	0.24
90	0.22
91	0.21
92	0.21
93	0.18
94	0.17
95	0.17
96	0.14
97	0.16
98	0.19
99	0.23
100	0.23
101	0.24
102	0.24
103	0.24
104	0.22
105	0.18
106	0.16
107	0.14
108	0.16
109	0.18
110	0.18
111	0.17
112	0.18
113	0.16
114	0.16
115	0.15
116	0.15
117	0.17
118	0.16
119	0.16
120	0.2
121	0.26
122	0.29
123	0.35
124	0.41
125	0.39
126	0.4
127	0.42
128	0.45
129	0.43
130	0.41
131	0.33
132	0.26
133	0.28
134	0.27
135	0.26
136	0.2
137	0.18
138	0.2
139	0.23
140	0.23
141	0.18
142	0.18
143	0.18
144	0.16
145	0.15
146	0.12
147	0.08
148	0.07
149	0.07
150	0.08
151	0.07
152	0.06
153	0.06
154	0.05
155	0.05
156	0.05
157	0.05
158	0.04
159	0.05
160	0.06
161	0.07
162	0.13
163	0.13
164	0.13
165	0.14
166	0.14
167	0.16
168	0.15
169	0.14
170	0.13
171	0.22
172	0.24
173	0.28
174	0.35
175	0.4
176	0.45
177	0.47
178	0.5
179	0.49
180	0.57
181	0.56
182	0.5
183	0.46
184	0.42
185	0.39
186	0.33
187	0.25
188	0.18
189	0.14
190	0.13
191	0.12
192	0.1
193	0.11
194	0.11
195	0.12
196	0.1
197	0.15
198	0.18
199	0.19
200	0.19
201	0.19
202	0.23
203	0.24
204	0.25
205	0.26
206	0.23
207	0.22
208	0.23
209	0.23
210	0.2
211	0.2
212	0.22
213	0.18
214	0.23
215	0.25
216	0.26
217	0.29
218	0.29
219	0.33
220	0.36
221	0.36
222	0.37
223	0.38
224	0.37
225	0.35
226	0.38
227	0.35
228	0.31
229	0.27
230	0.24
231	0.21
232	0.25
233	0.27
234	0.24
235	0.25
236	0.22
237	0.25
238	0.3
239	0.3
240	0.25
241	0.22
242	0.2
243	0.2
244	0.2
245	0.2
246	0.13
247	0.12
248	0.12
249	0.14
250	0.14
251	0.13
252	0.22
253	0.21
254	0.28
255	0.31
256	0.33
257	0.35
258	0.39
259	0.4
260	0.31
261	0.31
262	0.3
263	0.32
264	0.33
265	0.31
266	0.28
267	0.27
268	0.28
269	0.28
270	0.25
271	0.22
272	0.19
273	0.18
274	0.19
275	0.23
276	0.2
277	0.19
278	0.16
279	0.18
280	0.18
281	0.18
282	0.16
283	0.13
284	0.16
285	0.16
286	0.18
287	0.19
288	0.21
289	0.2
290	0.19
291	0.26
292	0.28
293	0.29
294	0.32
295	0.37
296	0.35
297	0.38
298	0.39
299	0.37
300	0.33
301	0.33
302	0.31
303	0.31
304	0.37
305	0.36
306	0.35
307	0.32
308	0.34
309	0.36
310	0.37
311	0.29
312	0.24
313	0.23
314	0.24
315	0.22
316	0.23
317	0.23
318	0.27
319	0.29
320	0.34
321	0.37
322	0.39
323	0.44
324	0.43
325	0.48
326	0.44
327	0.46
328	0.44
329	0.45
330	0.43
331	0.41
332	0.44
333	0.44
334	0.41
335	0.37
336	0.36
337	0.32
338	0.29
339	0.27
340	0.23
341	0.2
342	0.2
343	0.19
344	0.19
345	0.18
346	0.19
347	0.18
348	0.18
349	0.13
350	0.14
351	0.14
352	0.16
353	0.18
354	0.22
355	0.21
356	0.22
357	0.27
358	0.32
359	0.35
360	0.36
361	0.37
362	0.4
363	0.47
364	0.48
365	0.45
366	0.44
367	0.48
368	0.5
369	0.5
370	0.44
371	0.42
372	0.4
373	0.44
374	0.45
375	0.46
376	0.49
377	0.48
378	0.52
379	0.48
380	0.55
381	0.53
382	0.49
383	0.42
384	0.36
385	0.35
386	0.35
387	0.38
388	0.29
389	0.27
390	0.26
391	0.3
392	0.32
393	0.3
394	0.28
395	0.26
396	0.3
397	0.31
398	0.36
399	0.38
400	0.35
401	0.36
402	0.35
403	0.33
404	0.29
405	0.28
406	0.21
407	0.14
408	0.12
409	0.14
410	0.19
411	0.18
412	0.19
413	0.2
414	0.22
415	0.3
416	0.38
417	0.45
418	0.49
419	0.55
420	0.58
421	0.66
422	0.68
423	0.66
424	0.66
425	0.62
426	0.58
427	0.6
428	0.59
429	0.53
430	0.53
431	0.48
432	0.46
433	0.48
434	0.51
435	0.51
436	0.54
437	0.58
438	0.6
439	0.65
440	0.61
441	0.57
442	0.56
443	0.51
444	0.44
445	0.4
446	0.39
447	0.42
448	0.47
449	0.46
450	0.46
451	0.46
452	0.5
453	0.58
454	0.62
455	0.62
456	0.66
457	0.72
458	0.75
459	0.82
460	0.83
461	0.8
462	0.8
463	0.77
464	0.76
465	0.74
466	0.65
467	0.61
468	0.63
469	0.65
470	0.6
471	0.57

A0A5N5L1D5

3D AlphaFold-predicted Structure Viewer