Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MKZ4

Protein Details
Accession A0A5N5MKZ4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-129ASAIRKRRARRPRSSGSDKAHydrophilic
181-204NMVRLRPCIKKSKNYKARPTVLLYHydrophilic
NLS Segment(s)
PositionSequence
114-126RKRRARRPRSSGS
Subcellular Location(s) nucl 16, cyto_nucl 12.5, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MDTHSTATYPRATSEASRQHIGPPKAIGQILHRPWYDVVFALRLSQVVHVANGRRSVGRYFHRPSSSNVEEATYVLGSPQLSQGYDTSPLGCGFRWTILGNLEHAVDQHASAIRKRRARRPRSSGSDKAARGPVVQWSSVCWKRPNELGIREGTWVIKTTPQFNTCYTMAKTLSGANVSANMVRLRPCIKKSKNYKARPTVLLYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.38
4 0.39
5 0.39
6 0.44
7 0.51
8 0.5
9 0.44
10 0.38
11 0.37
12 0.38
13 0.38
14 0.32
15 0.29
16 0.36
17 0.37
18 0.4
19 0.37
20 0.35
21 0.35
22 0.36
23 0.3
24 0.22
25 0.19
26 0.15
27 0.15
28 0.14
29 0.13
30 0.12
31 0.12
32 0.11
33 0.12
34 0.1
35 0.11
36 0.13
37 0.16
38 0.18
39 0.2
40 0.21
41 0.19
42 0.21
43 0.22
44 0.26
45 0.28
46 0.34
47 0.36
48 0.42
49 0.46
50 0.45
51 0.47
52 0.5
53 0.46
54 0.4
55 0.35
56 0.29
57 0.25
58 0.23
59 0.2
60 0.1
61 0.08
62 0.06
63 0.07
64 0.06
65 0.06
66 0.08
67 0.07
68 0.07
69 0.08
70 0.09
71 0.09
72 0.11
73 0.11
74 0.09
75 0.1
76 0.1
77 0.1
78 0.09
79 0.09
80 0.08
81 0.08
82 0.09
83 0.08
84 0.09
85 0.11
86 0.11
87 0.1
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.06
94 0.06
95 0.06
96 0.08
97 0.09
98 0.11
99 0.2
100 0.24
101 0.31
102 0.36
103 0.45
104 0.54
105 0.63
106 0.71
107 0.71
108 0.75
109 0.77
110 0.81
111 0.77
112 0.72
113 0.7
114 0.61
115 0.55
116 0.48
117 0.39
118 0.32
119 0.26
120 0.26
121 0.21
122 0.21
123 0.17
124 0.17
125 0.25
126 0.28
127 0.31
128 0.3
129 0.3
130 0.32
131 0.37
132 0.39
133 0.38
134 0.38
135 0.37
136 0.35
137 0.34
138 0.32
139 0.28
140 0.24
141 0.18
142 0.15
143 0.14
144 0.16
145 0.16
146 0.2
147 0.26
148 0.28
149 0.29
150 0.29
151 0.34
152 0.3
153 0.33
154 0.3
155 0.28
156 0.27
157 0.25
158 0.24
159 0.21
160 0.22
161 0.18
162 0.17
163 0.12
164 0.14
165 0.14
166 0.14
167 0.14
168 0.13
169 0.14
170 0.15
171 0.19
172 0.22
173 0.28
174 0.33
175 0.42
176 0.49
177 0.58
178 0.67
179 0.75
180 0.8
181 0.83
182 0.88
183 0.88
184 0.87
185 0.82
186 0.79