Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5NXP1

Protein Details
Accession A0A5N5NXP1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-69DGEMPPEGKRRRRRKPEITETPEGNBasic
NLS Segment(s)
PositionSequence
52-60GKRRRRRKP
Subcellular Location(s) mito 8, plas 5, extr 4, E.R. 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MPPPHLHPRSRMTSSLFATTVFASFFVVALPHILPCPAPRVKYADGEMPPEGKRRRRRKPEITETPEGNIVDFGSSIEDEGPQTAKTKRECPVPKPGGAVGELLGFKKTTAGSDTRPSPDRTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.41
4 0.33
5 0.3
6 0.27
7 0.21
8 0.14
9 0.12
10 0.09
11 0.08
12 0.08
13 0.06
14 0.06
15 0.05
16 0.07
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.08
23 0.14
24 0.15
25 0.16
26 0.18
27 0.24
28 0.26
29 0.29
30 0.3
31 0.3
32 0.28
33 0.3
34 0.28
35 0.25
36 0.24
37 0.28
38 0.31
39 0.33
40 0.42
41 0.5
42 0.6
43 0.68
44 0.78
45 0.81
46 0.87
47 0.89
48 0.9
49 0.87
50 0.8
51 0.7
52 0.61
53 0.52
54 0.41
55 0.31
56 0.2
57 0.12
58 0.08
59 0.07
60 0.06
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.06
70 0.09
71 0.12
72 0.17
73 0.2
74 0.26
75 0.29
76 0.38
77 0.44
78 0.46
79 0.55
80 0.54
81 0.53
82 0.5
83 0.48
84 0.39
85 0.34
86 0.3
87 0.19
88 0.17
89 0.15
90 0.13
91 0.13
92 0.11
93 0.1
94 0.12
95 0.12
96 0.11
97 0.14
98 0.18
99 0.22
100 0.29
101 0.34
102 0.38
103 0.42
104 0.44