Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LIU4

Protein Details
Accession A0A5N5LIU4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
480-509NGNGHNKKMPPKAPPPRRRTKLKAVTSSADHydrophilic
NLS Segment(s)
PositionSequence
484-502HNKKMPPKAPPPRRRTKLK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR030125  SPIN90/Ldb17  
IPR018556  SPIN90/Ldb17_LRD  
Pfam View protein in Pfam  
PF09431  SPIN90_LRD  
Amino Acid Sequences MACQDEGICCAIESEQQFWDELGKILQSACDTSHEELDDALRGWLSLVSCCRDRFLHYEDDLASCSQELIDSRIFSDHKDYVRTQIIYSLLQEDEFCALHVIANFLLLDGRSDETTFRKMIDAGCFARLLDLMKECRDQDARLHRLLLELMYEMSRIEHLRIEDLMHVDDAFVMYLFQLIEAYSDDAHDPYHYPVIRVLLVLNEQYMVASTTPAVDPESPSVPLTNRVIKVLSVHGPHFRTFGENIILLLNRETETSLQLLILKLLYLLFTTKATYEYFYTNDLRVLLDVIIRNLLDLPNEVTALRHTYLRVLSPLLAHTQLSHPPHYKREEILKVLRILSGAGNAHFAPVDETTVRLVDRVAKVPWLAEDEDGSECGDVEVARKLLGISLSPTQSASSVSVVAGVMEKPGVRTPSRKTEFGPQSRDSMREVCDIVDAADQKTQLHMKSAARPKKVLPEVPKHRHGVPMGISKATAVHLNGNGHNKKMPPKAPPPRRRTKLKAVTSSADAAVTPETLHPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.19
5 0.18
6 0.21
7 0.17
8 0.16
9 0.15
10 0.13
11 0.13
12 0.13
13 0.14
14 0.13
15 0.13
16 0.13
17 0.16
18 0.19
19 0.21
20 0.24
21 0.23
22 0.22
23 0.21
24 0.21
25 0.19
26 0.16
27 0.14
28 0.11
29 0.1
30 0.1
31 0.11
32 0.11
33 0.13
34 0.16
35 0.2
36 0.24
37 0.25
38 0.27
39 0.27
40 0.3
41 0.32
42 0.33
43 0.37
44 0.34
45 0.37
46 0.36
47 0.35
48 0.33
49 0.27
50 0.23
51 0.14
52 0.14
53 0.1
54 0.1
55 0.1
56 0.12
57 0.15
58 0.15
59 0.16
60 0.2
61 0.2
62 0.2
63 0.26
64 0.27
65 0.27
66 0.31
67 0.32
68 0.33
69 0.4
70 0.4
71 0.34
72 0.33
73 0.32
74 0.28
75 0.28
76 0.24
77 0.17
78 0.16
79 0.16
80 0.13
81 0.13
82 0.12
83 0.11
84 0.09
85 0.09
86 0.1
87 0.1
88 0.11
89 0.09
90 0.09
91 0.09
92 0.08
93 0.09
94 0.07
95 0.07
96 0.07
97 0.09
98 0.09
99 0.09
100 0.11
101 0.14
102 0.17
103 0.17
104 0.16
105 0.16
106 0.17
107 0.2
108 0.22
109 0.24
110 0.23
111 0.24
112 0.23
113 0.22
114 0.21
115 0.18
116 0.15
117 0.13
118 0.15
119 0.16
120 0.18
121 0.21
122 0.21
123 0.25
124 0.25
125 0.24
126 0.28
127 0.36
128 0.38
129 0.37
130 0.38
131 0.33
132 0.32
133 0.32
134 0.24
135 0.14
136 0.1
137 0.09
138 0.08
139 0.08
140 0.07
141 0.07
142 0.08
143 0.08
144 0.09
145 0.1
146 0.11
147 0.12
148 0.13
149 0.14
150 0.14
151 0.14
152 0.14
153 0.11
154 0.11
155 0.09
156 0.08
157 0.07
158 0.06
159 0.04
160 0.04
161 0.03
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.06
170 0.05
171 0.06
172 0.07
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.14
179 0.14
180 0.14
181 0.15
182 0.17
183 0.16
184 0.15
185 0.14
186 0.1
187 0.1
188 0.1
189 0.09
190 0.07
191 0.06
192 0.06
193 0.06
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.07
202 0.07
203 0.08
204 0.1
205 0.11
206 0.11
207 0.11
208 0.12
209 0.11
210 0.14
211 0.16
212 0.19
213 0.18
214 0.18
215 0.19
216 0.18
217 0.19
218 0.18
219 0.19
220 0.15
221 0.16
222 0.2
223 0.21
224 0.22
225 0.21
226 0.19
227 0.17
228 0.16
229 0.16
230 0.13
231 0.12
232 0.12
233 0.12
234 0.11
235 0.09
236 0.09
237 0.08
238 0.06
239 0.06
240 0.06
241 0.06
242 0.07
243 0.07
244 0.07
245 0.06
246 0.07
247 0.07
248 0.07
249 0.06
250 0.05
251 0.04
252 0.04
253 0.04
254 0.03
255 0.04
256 0.04
257 0.05
258 0.06
259 0.06
260 0.07
261 0.08
262 0.09
263 0.1
264 0.11
265 0.11
266 0.14
267 0.15
268 0.14
269 0.14
270 0.14
271 0.12
272 0.11
273 0.1
274 0.08
275 0.08
276 0.08
277 0.07
278 0.08
279 0.07
280 0.07
281 0.07
282 0.07
283 0.06
284 0.06
285 0.07
286 0.07
287 0.07
288 0.07
289 0.07
290 0.08
291 0.1
292 0.1
293 0.1
294 0.09
295 0.12
296 0.13
297 0.13
298 0.14
299 0.12
300 0.12
301 0.12
302 0.12
303 0.12
304 0.11
305 0.1
306 0.1
307 0.12
308 0.16
309 0.18
310 0.21
311 0.25
312 0.27
313 0.33
314 0.36
315 0.36
316 0.34
317 0.4
318 0.41
319 0.42
320 0.44
321 0.42
322 0.4
323 0.38
324 0.35
325 0.27
326 0.23
327 0.17
328 0.15
329 0.12
330 0.1
331 0.11
332 0.1
333 0.1
334 0.09
335 0.09
336 0.08
337 0.08
338 0.09
339 0.08
340 0.09
341 0.09
342 0.1
343 0.1
344 0.08
345 0.09
346 0.13
347 0.15
348 0.17
349 0.17
350 0.18
351 0.18
352 0.18
353 0.19
354 0.16
355 0.15
356 0.12
357 0.12
358 0.12
359 0.13
360 0.13
361 0.12
362 0.08
363 0.08
364 0.07
365 0.07
366 0.05
367 0.06
368 0.08
369 0.08
370 0.08
371 0.09
372 0.09
373 0.1
374 0.1
375 0.09
376 0.1
377 0.13
378 0.14
379 0.14
380 0.15
381 0.13
382 0.13
383 0.14
384 0.13
385 0.1
386 0.1
387 0.09
388 0.1
389 0.09
390 0.09
391 0.09
392 0.07
393 0.07
394 0.07
395 0.07
396 0.08
397 0.11
398 0.15
399 0.17
400 0.22
401 0.28
402 0.39
403 0.44
404 0.44
405 0.44
406 0.51
407 0.58
408 0.61
409 0.62
410 0.53
411 0.55
412 0.55
413 0.54
414 0.47
415 0.4
416 0.35
417 0.31
418 0.29
419 0.23
420 0.22
421 0.2
422 0.18
423 0.18
424 0.16
425 0.14
426 0.16
427 0.16
428 0.15
429 0.19
430 0.21
431 0.18
432 0.21
433 0.26
434 0.28
435 0.37
436 0.48
437 0.52
438 0.53
439 0.55
440 0.54
441 0.59
442 0.62
443 0.61
444 0.59
445 0.62
446 0.68
447 0.74
448 0.78
449 0.71
450 0.66
451 0.64
452 0.56
453 0.52
454 0.48
455 0.49
456 0.44
457 0.41
458 0.39
459 0.32
460 0.32
461 0.26
462 0.22
463 0.14
464 0.16
465 0.2
466 0.24
467 0.29
468 0.37
469 0.39
470 0.38
471 0.41
472 0.4
473 0.45
474 0.51
475 0.52
476 0.51
477 0.6
478 0.69
479 0.77
480 0.83
481 0.84
482 0.86
483 0.89
484 0.9
485 0.88
486 0.88
487 0.87
488 0.87
489 0.87
490 0.82
491 0.78
492 0.71
493 0.65
494 0.54
495 0.44
496 0.34
497 0.25
498 0.2
499 0.15
500 0.12
501 0.1