Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5NU20

Protein Details
Accession A0A5N5NU20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-79APFSRPRYRCFHPRGRQHRYHRVRILMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2, extr 2
Family & Domain DBs
Amino Acid Sequences MAVTAKACRIAFWLTATVARLGKPRLVVPQYHSTTSIAGGASDLALPPSGMCAPFSRPRYRCFHPRGRQHRYHRVRILM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.2
5 0.18
6 0.17
7 0.19
8 0.18
9 0.19
10 0.19
11 0.2
12 0.24
13 0.26
14 0.26
15 0.28
16 0.36
17 0.36
18 0.35
19 0.35
20 0.28
21 0.26
22 0.25
23 0.2
24 0.11
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.05
36 0.05
37 0.05
38 0.07
39 0.08
40 0.13
41 0.21
42 0.26
43 0.34
44 0.36
45 0.42
46 0.48
47 0.53
48 0.58
49 0.6
50 0.66
51 0.66
52 0.75
53 0.81
54 0.83
55 0.87
56 0.86
57 0.89
58 0.87
59 0.88