Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MVJ4

Protein Details
Accession A0A5N5MVJ4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSARSSKVKSNNQKLKKNVFGPHydrophilic
NLS Segment(s)
PositionSequence
83-127PKSRDSKRRKAGPVLGKSGIQKRKAKKASIVFPSRTRKQAPTKKS
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARSSKVKSNNQKLKKNVFGPVEAARTERLAAKMQELIAQPKPSEAKKETEMDVEDTEGAADKTSAEHADETMEIDSGAPKSRDSKRRKAGPVLGKSGIQKRKAKKASIVFPSRTRKQAPTKKSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.87
4 0.85
5 0.83
6 0.76
7 0.73
8 0.65
9 0.57
10 0.52
11 0.48
12 0.41
13 0.33
14 0.3
15 0.23
16 0.21
17 0.2
18 0.19
19 0.17
20 0.18
21 0.18
22 0.19
23 0.2
24 0.19
25 0.22
26 0.21
27 0.23
28 0.23
29 0.23
30 0.21
31 0.22
32 0.25
33 0.22
34 0.27
35 0.25
36 0.26
37 0.28
38 0.31
39 0.29
40 0.28
41 0.28
42 0.24
43 0.22
44 0.18
45 0.14
46 0.11
47 0.1
48 0.08
49 0.06
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.06
67 0.06
68 0.09
69 0.08
70 0.09
71 0.15
72 0.24
73 0.33
74 0.4
75 0.5
76 0.58
77 0.67
78 0.72
79 0.74
80 0.75
81 0.75
82 0.74
83 0.69
84 0.61
85 0.54
86 0.53
87 0.54
88 0.51
89 0.5
90 0.51
91 0.52
92 0.61
93 0.66
94 0.67
95 0.67
96 0.69
97 0.7
98 0.73
99 0.74
100 0.68
101 0.7
102 0.74
103 0.71
104 0.68
105 0.64
106 0.63
107 0.66
108 0.71
109 0.71