Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LCW5

Protein Details
Accession A0A5N5LCW5    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-108DDHARQRPPPRRAHHRLRRTRTTGPBasic
177-196APPRKPDKPSLPPRPRVPTRBasic
NLS Segment(s)
PositionSequence
88-119RQRPPPRRAHHRLRRTRTTGPASPTRPAEKKR
145-198PPASRPRRERAAYGAAHQRRRTTPPREPPRTGAPPRKPDKPSLPPRPRVPTRLP
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 7, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MRREGDEVGGGEPPQVTSGKNKPPPRTFDSSYPTALRRPFSIILSSPDDCDALYDQIQPTLARIYRFFINFCDFEGFSTTITDDDHARQRPPPRRAHHRLRRTRTTGPASPTRPAEKKRLPEDELLHGTAPRGNVTPIGEEGAPPPASRPRRERAAYGAAHQRRRTTPPREPPRTGAPPRKPDKPSLPPRPRVPTRLPHTHYKGKPTTPSSGRTFTRQETEVRRRDGRGGFASAATRSAPRRRPSLLDGVAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.17
5 0.26
6 0.35
7 0.44
8 0.52
9 0.6
10 0.67
11 0.74
12 0.74
13 0.74
14 0.68
15 0.68
16 0.67
17 0.61
18 0.57
19 0.53
20 0.48
21 0.44
22 0.43
23 0.36
24 0.32
25 0.34
26 0.32
27 0.3
28 0.32
29 0.29
30 0.3
31 0.33
32 0.32
33 0.27
34 0.25
35 0.23
36 0.19
37 0.19
38 0.16
39 0.12
40 0.13
41 0.14
42 0.14
43 0.15
44 0.16
45 0.14
46 0.13
47 0.16
48 0.17
49 0.16
50 0.17
51 0.19
52 0.22
53 0.24
54 0.23
55 0.21
56 0.24
57 0.22
58 0.23
59 0.24
60 0.19
61 0.19
62 0.22
63 0.19
64 0.15
65 0.15
66 0.14
67 0.1
68 0.11
69 0.11
70 0.08
71 0.11
72 0.17
73 0.19
74 0.2
75 0.25
76 0.34
77 0.42
78 0.48
79 0.55
80 0.56
81 0.65
82 0.73
83 0.79
84 0.81
85 0.82
86 0.85
87 0.84
88 0.85
89 0.81
90 0.78
91 0.74
92 0.71
93 0.64
94 0.59
95 0.57
96 0.51
97 0.47
98 0.44
99 0.42
100 0.4
101 0.39
102 0.43
103 0.42
104 0.46
105 0.5
106 0.53
107 0.5
108 0.49
109 0.49
110 0.45
111 0.41
112 0.34
113 0.28
114 0.22
115 0.19
116 0.16
117 0.14
118 0.09
119 0.08
120 0.07
121 0.08
122 0.09
123 0.09
124 0.08
125 0.09
126 0.08
127 0.08
128 0.08
129 0.11
130 0.1
131 0.09
132 0.1
133 0.17
134 0.21
135 0.26
136 0.31
137 0.33
138 0.41
139 0.43
140 0.44
141 0.42
142 0.46
143 0.42
144 0.41
145 0.45
146 0.42
147 0.46
148 0.46
149 0.44
150 0.4
151 0.46
152 0.5
153 0.5
154 0.54
155 0.59
156 0.68
157 0.72
158 0.72
159 0.7
160 0.7
161 0.71
162 0.7
163 0.69
164 0.68
165 0.7
166 0.71
167 0.75
168 0.69
169 0.67
170 0.68
171 0.69
172 0.7
173 0.72
174 0.76
175 0.75
176 0.8
177 0.82
178 0.78
179 0.74
180 0.71
181 0.69
182 0.68
183 0.71
184 0.67
185 0.67
186 0.69
187 0.72
188 0.69
189 0.68
190 0.67
191 0.62
192 0.65
193 0.6
194 0.62
195 0.56
196 0.59
197 0.55
198 0.56
199 0.53
200 0.5
201 0.51
202 0.46
203 0.46
204 0.42
205 0.43
206 0.46
207 0.54
208 0.56
209 0.58
210 0.59
211 0.56
212 0.61
213 0.58
214 0.55
215 0.49
216 0.46
217 0.4
218 0.37
219 0.37
220 0.3
221 0.28
222 0.22
223 0.22
224 0.24
225 0.32
226 0.39
227 0.42
228 0.48
229 0.51
230 0.56
231 0.58
232 0.62
233 0.56