Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5N8G7

Protein Details
Accession A0A5N5N8G7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-85VERAERWTERRRNRKIGETGKGKBasic
NLS Segment(s)
PositionSequence
71-88ERRRNRKIGETGKGKAKG
Subcellular Location(s) plas 9, mito 6, extr 6, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDRPALSVLVVMVVVMAFLNVVAWFSGVPLSSRLSHTLSPSLRECRVTSAVGICKVTMALPDVERAERWTERRRNRKIGETGKGKAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.05
14 0.05
15 0.06
16 0.07
17 0.09
18 0.1
19 0.12
20 0.14
21 0.16
22 0.17
23 0.18
24 0.23
25 0.21
26 0.23
27 0.25
28 0.26
29 0.25
30 0.25
31 0.24
32 0.22
33 0.23
34 0.2
35 0.18
36 0.18
37 0.2
38 0.19
39 0.19
40 0.15
41 0.13
42 0.13
43 0.12
44 0.09
45 0.08
46 0.08
47 0.08
48 0.1
49 0.12
50 0.12
51 0.13
52 0.14
53 0.18
54 0.2
55 0.26
56 0.34
57 0.42
58 0.52
59 0.63
60 0.7
61 0.75
62 0.78
63 0.82
64 0.82
65 0.82
66 0.82
67 0.78
68 0.75