Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MYH8

Protein Details
Accession A0A5N5MYH8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-56RPAGWSQSQRLRRRRARPINKRQGPYQHydrophilic
NLS Segment(s)
PositionSequence
38-51QRLRRRRARPINKR
Subcellular Location(s) plas 12, nucl 8, mito 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031814  ALG11_N  
Pfam View protein in Pfam  
PF15924  ALG11_N  
Amino Acid Sequences MAGAEINKFPVQKEKQEDHPSNIKDKGGLRPAGWSQSQRLRRRRARPINKRQGPYQGHNFPRPRTPYPSSTRPVPVSPPQITARHSQVFDSQTQVEINTTTSLPTDTVQHPTAPVPVQSRFSLTAYMPLVLGPVSVGKVSAGQSKTVRLQLSLGSIILAWGAFSLLLADVFVDTMRYAFALGLSELLFHDVPIGAYVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.65
4 0.68
5 0.65
6 0.69
7 0.64
8 0.61
9 0.59
10 0.5
11 0.43
12 0.42
13 0.44
14 0.42
15 0.41
16 0.35
17 0.37
18 0.39
19 0.4
20 0.39
21 0.33
22 0.32
23 0.38
24 0.48
25 0.52
26 0.59
27 0.64
28 0.71
29 0.78
30 0.84
31 0.86
32 0.88
33 0.9
34 0.92
35 0.93
36 0.92
37 0.86
38 0.78
39 0.77
40 0.72
41 0.68
42 0.66
43 0.63
44 0.6
45 0.64
46 0.64
47 0.56
48 0.58
49 0.57
50 0.52
51 0.51
52 0.51
53 0.51
54 0.54
55 0.59
56 0.55
57 0.52
58 0.52
59 0.47
60 0.43
61 0.4
62 0.39
63 0.38
64 0.36
65 0.36
66 0.35
67 0.35
68 0.36
69 0.34
70 0.33
71 0.29
72 0.28
73 0.25
74 0.26
75 0.25
76 0.24
77 0.23
78 0.18
79 0.16
80 0.15
81 0.15
82 0.11
83 0.09
84 0.09
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.09
93 0.1
94 0.14
95 0.14
96 0.14
97 0.15
98 0.14
99 0.16
100 0.13
101 0.15
102 0.14
103 0.15
104 0.17
105 0.17
106 0.19
107 0.19
108 0.19
109 0.18
110 0.15
111 0.18
112 0.16
113 0.16
114 0.14
115 0.12
116 0.11
117 0.09
118 0.09
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.06
126 0.08
127 0.14
128 0.14
129 0.17
130 0.18
131 0.22
132 0.25
133 0.28
134 0.27
135 0.21
136 0.22
137 0.2
138 0.21
139 0.19
140 0.16
141 0.11
142 0.11
143 0.1
144 0.09
145 0.07
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.07
168 0.07
169 0.08
170 0.08
171 0.08
172 0.08
173 0.12
174 0.11
175 0.09
176 0.1
177 0.09
178 0.1