Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5KEP0

Protein Details
Accession A0A5N5KEP0    Localization Confidence High Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSDRIQKPKKQPKQPKPSTARKNKLLQVHydrophilic
75-99ERRIIDAKIKRIRKQKKNEVYGDIVHydrophilic
NLS Segment(s)
PositionSequence
7-22KPKKQPKQPKPSTARK
82-90KIKRIRKQK
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
Amino Acid Sequences MSDRIQKPKKQPKQPKPSTARKNKLLQVLLDSDLVEMPSYSNCEKKGLEFSVKNLERTRKQFYEYELALEKLEEERRIIDAKIKRIRKQKKNEVYGDIVLSPTTLEAIIQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.91
4 0.92
5 0.92
6 0.91
7 0.89
8 0.86
9 0.84
10 0.78
11 0.77
12 0.68
13 0.58
14 0.51
15 0.45
16 0.38
17 0.31
18 0.25
19 0.17
20 0.14
21 0.13
22 0.09
23 0.06
24 0.05
25 0.05
26 0.08
27 0.09
28 0.11
29 0.12
30 0.15
31 0.15
32 0.16
33 0.21
34 0.21
35 0.26
36 0.24
37 0.25
38 0.33
39 0.34
40 0.35
41 0.33
42 0.35
43 0.34
44 0.39
45 0.44
46 0.35
47 0.37
48 0.37
49 0.37
50 0.38
51 0.33
52 0.31
53 0.25
54 0.24
55 0.21
56 0.19
57 0.16
58 0.12
59 0.14
60 0.12
61 0.11
62 0.12
63 0.13
64 0.15
65 0.15
66 0.2
67 0.23
68 0.32
69 0.4
70 0.46
71 0.52
72 0.61
73 0.72
74 0.74
75 0.8
76 0.82
77 0.84
78 0.86
79 0.85
80 0.8
81 0.74
82 0.66
83 0.57
84 0.47
85 0.36
86 0.27
87 0.21
88 0.15
89 0.09
90 0.08
91 0.06