Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5PNU1

Protein Details
Accession A0A5N5PNU1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-35VTPNACTECRRKRTKCDGQKPCSRCEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences SKRRRGVGVVTPNACTECRRKRTKCDGQKPCSRCEGLGISECVYEVPVRQSKEHLRKEIQRLQHEQRSSDRVFAALASSDLSGDVLARLRSGQPVESISEWLSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.32
4 0.34
5 0.42
6 0.51
7 0.56
8 0.65
9 0.75
10 0.83
11 0.85
12 0.86
13 0.87
14 0.85
15 0.89
16 0.82
17 0.74
18 0.69
19 0.59
20 0.48
21 0.41
22 0.36
23 0.29
24 0.28
25 0.25
26 0.2
27 0.19
28 0.18
29 0.14
30 0.11
31 0.09
32 0.06
33 0.1
34 0.13
35 0.15
36 0.15
37 0.2
38 0.28
39 0.38
40 0.43
41 0.43
42 0.44
43 0.49
44 0.57
45 0.6
46 0.58
47 0.54
48 0.56
49 0.57
50 0.58
51 0.53
52 0.47
53 0.45
54 0.44
55 0.39
56 0.35
57 0.28
58 0.22
59 0.21
60 0.19
61 0.15
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.08
75 0.09
76 0.1
77 0.14
78 0.16
79 0.16
80 0.16
81 0.18
82 0.22
83 0.22
84 0.23