Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5P9R1

Protein Details
Accession A0A5N5P9R1    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
279-301GAGNCKPWVRYLPKRPRRGGAAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10extr 10, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033697  Ribonuclease_T2_eukaryotic  
IPR001568  RNase_T2-like  
IPR036430  RNase_T2-like_sf  
IPR018188  RNase_T2_His_AS_1  
IPR033130  RNase_T2_His_AS_2  
Gene Ontology GO:0033897  F:ribonuclease T2 activity  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00445  Ribonuclease_T2  
PROSITE View protein in PROSITE  
PS00530  RNASE_T2_1  
PS00531  RNASE_T2_2  
CDD cd01061  RNase_T2_euk  
Amino Acid Sequences MLLSIRSVLVYASTLLSQSRLVHASSSSSNPDSQSILNTQASLPSPYVPLSGSVSCPIDGPMSCHNNTPIAGDSCCFVYPGGRMLLTQFWDAEEQAPGSDKDWTIHGLWPDLCDGTYDAYCRLTPSYPNITAVLLSHNATSLLSYMSRYWTAAWGSASHLWAHEYNKHGTCINTLSASCYSSYTPGVEVVDYFSRAASLHKTLDTYTALKKAGIAPKRDERYPLAEVKRALEEYSGGRVVLRCTGRGDVLHEAWYVFFVQGSLQSGEFVPAAKLGREGGAGNCKPWVRYLPKRPRRGGAAQVGAEEEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.12
5 0.13
6 0.16
7 0.16
8 0.16
9 0.17
10 0.18
11 0.2
12 0.21
13 0.23
14 0.24
15 0.25
16 0.26
17 0.26
18 0.27
19 0.25
20 0.23
21 0.23
22 0.2
23 0.23
24 0.22
25 0.21
26 0.2
27 0.21
28 0.22
29 0.21
30 0.19
31 0.15
32 0.16
33 0.16
34 0.17
35 0.13
36 0.14
37 0.15
38 0.16
39 0.16
40 0.17
41 0.18
42 0.17
43 0.17
44 0.16
45 0.15
46 0.14
47 0.17
48 0.22
49 0.26
50 0.26
51 0.28
52 0.28
53 0.28
54 0.28
55 0.26
56 0.22
57 0.2
58 0.19
59 0.17
60 0.17
61 0.16
62 0.16
63 0.14
64 0.1
65 0.09
66 0.1
67 0.12
68 0.13
69 0.12
70 0.11
71 0.13
72 0.15
73 0.16
74 0.15
75 0.12
76 0.12
77 0.13
78 0.13
79 0.12
80 0.1
81 0.09
82 0.08
83 0.1
84 0.09
85 0.09
86 0.11
87 0.1
88 0.1
89 0.11
90 0.13
91 0.13
92 0.15
93 0.15
94 0.16
95 0.15
96 0.16
97 0.15
98 0.13
99 0.12
100 0.1
101 0.1
102 0.09
103 0.09
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.11
110 0.1
111 0.11
112 0.16
113 0.22
114 0.22
115 0.23
116 0.23
117 0.21
118 0.2
119 0.19
120 0.15
121 0.1
122 0.1
123 0.08
124 0.08
125 0.08
126 0.07
127 0.07
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.08
134 0.08
135 0.08
136 0.08
137 0.1
138 0.1
139 0.1
140 0.1
141 0.09
142 0.11
143 0.12
144 0.12
145 0.1
146 0.1
147 0.1
148 0.12
149 0.13
150 0.14
151 0.15
152 0.19
153 0.2
154 0.21
155 0.2
156 0.19
157 0.19
158 0.18
159 0.16
160 0.13
161 0.12
162 0.13
163 0.13
164 0.13
165 0.12
166 0.11
167 0.11
168 0.11
169 0.12
170 0.1
171 0.09
172 0.1
173 0.09
174 0.08
175 0.08
176 0.09
177 0.09
178 0.09
179 0.09
180 0.08
181 0.08
182 0.08
183 0.09
184 0.1
185 0.12
186 0.13
187 0.13
188 0.14
189 0.14
190 0.17
191 0.18
192 0.17
193 0.17
194 0.19
195 0.19
196 0.18
197 0.19
198 0.22
199 0.28
200 0.3
201 0.32
202 0.35
203 0.43
204 0.47
205 0.47
206 0.45
207 0.41
208 0.41
209 0.42
210 0.44
211 0.38
212 0.39
213 0.39
214 0.37
215 0.37
216 0.31
217 0.27
218 0.2
219 0.18
220 0.16
221 0.19
222 0.17
223 0.14
224 0.14
225 0.14
226 0.15
227 0.2
228 0.19
229 0.17
230 0.19
231 0.2
232 0.21
233 0.21
234 0.24
235 0.22
236 0.22
237 0.23
238 0.21
239 0.19
240 0.18
241 0.17
242 0.14
243 0.09
244 0.08
245 0.06
246 0.06
247 0.08
248 0.11
249 0.12
250 0.11
251 0.12
252 0.12
253 0.14
254 0.13
255 0.12
256 0.09
257 0.11
258 0.12
259 0.11
260 0.12
261 0.12
262 0.12
263 0.13
264 0.14
265 0.16
266 0.25
267 0.25
268 0.25
269 0.29
270 0.29
271 0.28
272 0.31
273 0.35
274 0.35
275 0.45
276 0.55
277 0.62
278 0.71
279 0.81
280 0.83
281 0.82
282 0.8
283 0.77
284 0.76
285 0.74
286 0.72
287 0.62
288 0.57
289 0.51