Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DKK5

Protein Details
Accession C5DKK5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
9-37TLPQRTVHKAPRIRKHRSARSQTHRQMHYHydrophilic
NLS Segment(s)
PositionSequence
19-25PRIRKHR
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
KEGG lth:KLTH0F05478g  -  
Amino Acid Sequences MRSHNGSRTLPQRTVHKAPRIRKHRSARSQTHRQMHYAPEQPRQGVLVDERFGDVLPQQPAGVFFLVEVHTDSPGLTPHEIVEPGAEREGSRVELEAEEVLGTGAGADEDEDVEMRDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.64
4 0.66
5 0.71
6 0.77
7 0.79
8 0.8
9 0.8
10 0.83
11 0.84
12 0.86
13 0.87
14 0.87
15 0.87
16 0.89
17 0.87
18 0.85
19 0.76
20 0.69
21 0.62
22 0.55
23 0.53
24 0.5
25 0.45
26 0.42
27 0.42
28 0.4
29 0.37
30 0.33
31 0.26
32 0.2
33 0.18
34 0.14
35 0.13
36 0.13
37 0.12
38 0.11
39 0.11
40 0.1
41 0.08
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.1
49 0.1
50 0.06
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.06
61 0.07
62 0.09
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.11
72 0.11
73 0.11
74 0.09
75 0.1
76 0.12
77 0.12
78 0.1
79 0.1
80 0.11
81 0.1
82 0.12
83 0.1
84 0.09
85 0.08
86 0.07
87 0.07
88 0.05
89 0.05
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05