Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5KY61

Protein Details
Accession A0A5N5KY61    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
104-127DHARQRPPPRRAHHRLRRTRTTGPBasic
195-215GAPPRKPDKPSLPPRPRVPTRBasic
NLS Segment(s)
PositionSequence
107-138RQRPPPRRAHHRLRRTRTTGPASPTRPAEKKR
164-217PPASRPRRERAAYGAAHQRRRTTPPREPPRTGAPPRKPDKPSLPPRPRVPTRLP
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MCGSRQRRNGCDSELGKCQGLVDSKALTDGEPPQVTSGKNKPPPRTFDSSYPTALRRPFSIILSSPDDCDALYDQIQPTLARIYRFFINFCDFEGFSTTITDDDHARQRPPPRRAHHRLRRTRTTGPASPTRPAEKKRLPEDELLHGTAPRGNVTPIGEEGAPPPASRPRRERAAYGAAHQRRRTTPPREPPRTGAPPRKPDKPSLPPRPRVPTRLPHTHYKGKPTTPSSGRTFTRQETEVRRRDGRGGFASAATRSAPRRRPSLLDGVAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.43
4 0.38
5 0.34
6 0.28
7 0.29
8 0.26
9 0.21
10 0.2
11 0.19
12 0.21
13 0.2
14 0.16
15 0.16
16 0.17
17 0.21
18 0.21
19 0.21
20 0.22
21 0.24
22 0.25
23 0.29
24 0.34
25 0.37
26 0.45
27 0.53
28 0.6
29 0.65
30 0.71
31 0.72
32 0.72
33 0.66
34 0.66
35 0.65
36 0.59
37 0.55
38 0.51
39 0.45
40 0.42
41 0.4
42 0.34
43 0.29
44 0.31
45 0.29
46 0.28
47 0.3
48 0.26
49 0.28
50 0.31
51 0.3
52 0.25
53 0.23
54 0.22
55 0.18
56 0.17
57 0.14
58 0.11
59 0.12
60 0.13
61 0.13
62 0.13
63 0.14
64 0.13
65 0.12
66 0.15
67 0.16
68 0.15
69 0.15
70 0.18
71 0.21
72 0.22
73 0.22
74 0.2
75 0.22
76 0.21
77 0.22
78 0.22
79 0.18
80 0.18
81 0.2
82 0.18
83 0.14
84 0.14
85 0.13
86 0.1
87 0.1
88 0.1
89 0.08
90 0.1
91 0.16
92 0.18
93 0.19
94 0.23
95 0.32
96 0.41
97 0.47
98 0.53
99 0.55
100 0.64
101 0.71
102 0.78
103 0.8
104 0.81
105 0.84
106 0.83
107 0.84
108 0.8
109 0.76
110 0.73
111 0.69
112 0.62
113 0.57
114 0.56
115 0.49
116 0.45
117 0.42
118 0.4
119 0.38
120 0.37
121 0.41
122 0.4
123 0.44
124 0.48
125 0.51
126 0.48
127 0.48
128 0.47
129 0.44
130 0.4
131 0.34
132 0.28
133 0.22
134 0.2
135 0.17
136 0.14
137 0.1
138 0.08
139 0.08
140 0.09
141 0.09
142 0.1
143 0.09
144 0.1
145 0.09
146 0.09
147 0.09
148 0.11
149 0.11
150 0.1
151 0.11
152 0.18
153 0.22
154 0.27
155 0.32
156 0.34
157 0.43
158 0.45
159 0.45
160 0.44
161 0.48
162 0.43
163 0.42
164 0.46
165 0.44
166 0.48
167 0.47
168 0.45
169 0.41
170 0.48
171 0.52
172 0.51
173 0.55
174 0.6
175 0.69
176 0.73
177 0.73
178 0.71
179 0.71
180 0.72
181 0.71
182 0.7
183 0.69
184 0.71
185 0.72
186 0.76
187 0.7
188 0.68
189 0.69
190 0.69
191 0.71
192 0.72
193 0.77
194 0.76
195 0.8
196 0.83
197 0.78
198 0.75
199 0.72
200 0.7
201 0.69
202 0.71
203 0.68
204 0.68
205 0.7
206 0.73
207 0.69
208 0.69
209 0.68
210 0.62
211 0.66
212 0.61
213 0.62
214 0.57
215 0.6
216 0.56
217 0.57
218 0.53
219 0.51
220 0.52
221 0.46
222 0.47
223 0.43
224 0.44
225 0.47
226 0.55
227 0.57
228 0.59
229 0.59
230 0.56
231 0.62
232 0.59
233 0.55
234 0.5
235 0.46
236 0.4
237 0.38
238 0.38
239 0.31
240 0.28
241 0.22
242 0.22
243 0.24
244 0.32
245 0.39
246 0.42
247 0.48
248 0.51
249 0.56
250 0.59
251 0.62
252 0.57