Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5M4S1

Protein Details
Accession A0A5N5M4S1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23SKNSNKPKAWMRHDKTKSGYHydrophilic
NLS Segment(s)
PositionSequence
127-132SPKRPR
223-227RKRAK
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MSDSKNSNKPKAWMRHDKTKSGYIVRMTLDNGYKAYRPEFTCCLHIGNWYAWRTDNKGGMDCAHRTWNRYGRRFLSCRDPKPFSPEAENMAHRQIEFRENAPIDMDEWVEEKRKRLSARYVPAEPGSPKRPRARPMVSSDPIEEGRAMAADERMPLPPDKSAQFHTGVRVLSPDSEEKELEELRRRGLLYDEAEPSRGVLRLGDIWHDEPAYSIRQVTTTTRRKRAKGKSTAAPIAEGMDEEMGDFFVPEEVFESWAEFAKESGFEFVLLDDLVSNAESWVELEDKDVATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.8
4 0.81
5 0.76
6 0.73
7 0.69
8 0.63
9 0.61
10 0.53
11 0.51
12 0.45
13 0.41
14 0.35
15 0.34
16 0.3
17 0.27
18 0.25
19 0.23
20 0.23
21 0.24
22 0.25
23 0.26
24 0.26
25 0.3
26 0.33
27 0.34
28 0.35
29 0.34
30 0.34
31 0.29
32 0.29
33 0.26
34 0.25
35 0.29
36 0.26
37 0.26
38 0.27
39 0.29
40 0.31
41 0.33
42 0.35
43 0.31
44 0.32
45 0.32
46 0.32
47 0.33
48 0.3
49 0.28
50 0.31
51 0.3
52 0.32
53 0.39
54 0.44
55 0.49
56 0.53
57 0.58
58 0.55
59 0.62
60 0.61
61 0.56
62 0.59
63 0.59
64 0.6
65 0.61
66 0.61
67 0.54
68 0.59
69 0.59
70 0.51
71 0.47
72 0.42
73 0.39
74 0.38
75 0.38
76 0.32
77 0.31
78 0.29
79 0.22
80 0.22
81 0.19
82 0.19
83 0.19
84 0.18
85 0.22
86 0.22
87 0.22
88 0.22
89 0.2
90 0.16
91 0.15
92 0.14
93 0.08
94 0.08
95 0.09
96 0.14
97 0.15
98 0.17
99 0.2
100 0.24
101 0.26
102 0.3
103 0.38
104 0.41
105 0.48
106 0.51
107 0.49
108 0.46
109 0.45
110 0.43
111 0.35
112 0.32
113 0.3
114 0.29
115 0.33
116 0.39
117 0.44
118 0.45
119 0.52
120 0.53
121 0.52
122 0.55
123 0.58
124 0.52
125 0.48
126 0.44
127 0.38
128 0.32
129 0.27
130 0.2
131 0.11
132 0.08
133 0.07
134 0.06
135 0.04
136 0.05
137 0.04
138 0.05
139 0.06
140 0.06
141 0.08
142 0.08
143 0.09
144 0.1
145 0.12
146 0.13
147 0.14
148 0.17
149 0.18
150 0.2
151 0.2
152 0.21
153 0.22
154 0.2
155 0.18
156 0.16
157 0.13
158 0.11
159 0.12
160 0.12
161 0.11
162 0.13
163 0.13
164 0.13
165 0.15
166 0.16
167 0.17
168 0.23
169 0.22
170 0.21
171 0.24
172 0.23
173 0.21
174 0.22
175 0.24
176 0.18
177 0.21
178 0.23
179 0.21
180 0.22
181 0.21
182 0.19
183 0.16
184 0.14
185 0.11
186 0.07
187 0.09
188 0.1
189 0.11
190 0.12
191 0.13
192 0.14
193 0.15
194 0.15
195 0.13
196 0.11
197 0.13
198 0.13
199 0.12
200 0.11
201 0.11
202 0.12
203 0.14
204 0.19
205 0.27
206 0.35
207 0.43
208 0.52
209 0.59
210 0.64
211 0.73
212 0.78
213 0.78
214 0.78
215 0.78
216 0.76
217 0.77
218 0.76
219 0.67
220 0.57
221 0.46
222 0.37
223 0.29
224 0.21
225 0.13
226 0.08
227 0.07
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.04
234 0.06
235 0.06
236 0.06
237 0.08
238 0.08
239 0.1
240 0.1
241 0.11
242 0.1
243 0.13
244 0.14
245 0.11
246 0.11
247 0.11
248 0.12
249 0.12
250 0.14
251 0.12
252 0.11
253 0.11
254 0.11
255 0.11
256 0.1
257 0.09
258 0.06
259 0.06
260 0.07
261 0.07
262 0.07
263 0.05
264 0.06
265 0.06
266 0.06
267 0.08
268 0.08
269 0.08
270 0.1
271 0.12