Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5KT44

Protein Details
Accession A0A5N5KT44    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
254-275YTSQAGRKNNRKTRGARRTVKIHydrophilic
NLS Segment(s)
PositionSequence
264-268RKTRG
Subcellular Location(s) extr 24, mito 1, plas 1, golg 1
Family & Domain DBs
Amino Acid Sequences MAFVGMIMEVAGILTTISFAAVQGMGGYNGAATGVKIIAGQGDGSIGGSTPHIALWDDHGSRIGQYHPGKKEKTIDENGQRSVVIKHDQTTPPGRQADPMYVMLSNFENNAICVSAVYVSNGKISGTFYGDVGFMCGMDWYPSSGVIDSNFYAPRCVWLDADHTNGINARALSFHLNDVAAQPDKLAEYNDNPDTLCKSTPRFSFWGNLEPDGQIPFFNPPLKYNTDSVNGGQGSDKDPLAVIDKPNQYDKSVYTSQAGRKNNRKTRGARRTVKISNINSDHLVVTDMPSHSAREVCEHPNSVGWDIVSTTEGLFCHLTDRQLYPLCSGTVTVNCFDMGTLQLKTLVQRDGNFAVQPRGYNTTAHWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.04
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.05
16 0.05
17 0.06
18 0.05
19 0.04
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.13
43 0.19
44 0.19
45 0.19
46 0.21
47 0.2
48 0.2
49 0.21
50 0.18
51 0.2
52 0.25
53 0.33
54 0.39
55 0.47
56 0.48
57 0.51
58 0.58
59 0.56
60 0.58
61 0.57
62 0.59
63 0.6
64 0.63
65 0.6
66 0.53
67 0.46
68 0.39
69 0.33
70 0.28
71 0.23
72 0.2
73 0.21
74 0.27
75 0.29
76 0.33
77 0.38
78 0.37
79 0.39
80 0.41
81 0.39
82 0.35
83 0.35
84 0.34
85 0.31
86 0.29
87 0.23
88 0.21
89 0.2
90 0.18
91 0.16
92 0.13
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.09
108 0.09
109 0.09
110 0.08
111 0.09
112 0.09
113 0.1
114 0.1
115 0.09
116 0.1
117 0.1
118 0.09
119 0.09
120 0.08
121 0.05
122 0.05
123 0.05
124 0.04
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.07
131 0.07
132 0.07
133 0.07
134 0.09
135 0.08
136 0.1
137 0.12
138 0.11
139 0.12
140 0.11
141 0.14
142 0.14
143 0.15
144 0.13
145 0.13
146 0.17
147 0.17
148 0.2
149 0.18
150 0.15
151 0.14
152 0.15
153 0.14
154 0.11
155 0.1
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.1
167 0.08
168 0.08
169 0.07
170 0.07
171 0.07
172 0.07
173 0.08
174 0.06
175 0.08
176 0.12
177 0.13
178 0.13
179 0.13
180 0.13
181 0.14
182 0.15
183 0.14
184 0.12
185 0.14
186 0.2
187 0.21
188 0.25
189 0.24
190 0.24
191 0.28
192 0.28
193 0.33
194 0.29
195 0.28
196 0.25
197 0.23
198 0.22
199 0.18
200 0.16
201 0.09
202 0.08
203 0.09
204 0.11
205 0.14
206 0.14
207 0.14
208 0.18
209 0.22
210 0.24
211 0.24
212 0.25
213 0.25
214 0.25
215 0.24
216 0.25
217 0.21
218 0.19
219 0.18
220 0.15
221 0.15
222 0.15
223 0.15
224 0.1
225 0.1
226 0.1
227 0.12
228 0.14
229 0.13
230 0.19
231 0.22
232 0.23
233 0.28
234 0.29
235 0.27
236 0.27
237 0.27
238 0.26
239 0.26
240 0.26
241 0.23
242 0.27
243 0.32
244 0.38
245 0.44
246 0.45
247 0.52
248 0.62
249 0.67
250 0.7
251 0.72
252 0.73
253 0.78
254 0.81
255 0.82
256 0.8
257 0.78
258 0.79
259 0.75
260 0.75
261 0.72
262 0.64
263 0.63
264 0.57
265 0.53
266 0.45
267 0.41
268 0.33
269 0.24
270 0.23
271 0.14
272 0.12
273 0.14
274 0.13
275 0.14
276 0.15
277 0.15
278 0.15
279 0.17
280 0.16
281 0.17
282 0.21
283 0.23
284 0.27
285 0.28
286 0.27
287 0.3
288 0.31
289 0.28
290 0.24
291 0.2
292 0.16
293 0.15
294 0.15
295 0.12
296 0.09
297 0.08
298 0.09
299 0.09
300 0.11
301 0.11
302 0.1
303 0.13
304 0.14
305 0.16
306 0.18
307 0.19
308 0.23
309 0.28
310 0.29
311 0.28
312 0.29
313 0.27
314 0.24
315 0.24
316 0.21
317 0.2
318 0.22
319 0.2
320 0.19
321 0.18
322 0.18
323 0.16
324 0.14
325 0.13
326 0.14
327 0.13
328 0.13
329 0.16
330 0.16
331 0.19
332 0.22
333 0.24
334 0.24
335 0.25
336 0.31
337 0.32
338 0.34
339 0.33
340 0.32
341 0.33
342 0.31
343 0.31
344 0.3
345 0.32
346 0.3
347 0.29