Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DIX4

Protein Details
Accession C5DIX4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-32LNSRHARPSPGTSRRRSRRIIQFTNFSHydrophilic
NLS Segment(s)
PositionSequence
15-24PGTSRRRSRR
35-104SRGGRGGPRGGGRGGFGGGRGGARGGFGGGRGGARGGFGGGRGGPRGGARGGPRGGARGGARGGARGGAK
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000692  Fibrillarin  
IPR020813  Fibrillarin_CS  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003723  F:RNA binding  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
KEGG lth:KLTH0E15906g  -  
Pfam View protein in Pfam  
PF01269  Fibrillarin  
PROSITE View protein in PROSITE  
PS00566  FIBRILLARIN  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAIRPLNSRHARPSPGTSRRRSRRIIQFTNFSIGSRGGRGGPRGGGRGGFGGGRGGARGGFGGGRGGARGGFGGGRGGPRGGARGGPRGGARGGARGGARGGAKVVIEPHKHAGVFIARGKEDLLVTKNIAPGDSVYGEKRVSVEEPSKEDGAPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVADVVGPEGLVYAVEFSHRPGRELISMAKKRPNVIPIIEDARHPQKYRMLIGMVDAVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLRDERIKPLEQLTLEPYERDHCIVIGRYMRSGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.72
4 0.72
5 0.76
6 0.81
7 0.85
8 0.82
9 0.81
10 0.82
11 0.84
12 0.84
13 0.81
14 0.78
15 0.73
16 0.72
17 0.62
18 0.51
19 0.43
20 0.35
21 0.29
22 0.23
23 0.21
24 0.19
25 0.22
26 0.24
27 0.24
28 0.27
29 0.28
30 0.29
31 0.29
32 0.25
33 0.23
34 0.22
35 0.2
36 0.16
37 0.13
38 0.11
39 0.11
40 0.1
41 0.09
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.12
68 0.12
69 0.15
70 0.16
71 0.21
72 0.22
73 0.23
74 0.23
75 0.23
76 0.23
77 0.22
78 0.2
79 0.17
80 0.17
81 0.18
82 0.17
83 0.16
84 0.16
85 0.15
86 0.15
87 0.12
88 0.12
89 0.1
90 0.1
91 0.1
92 0.14
93 0.18
94 0.19
95 0.21
96 0.23
97 0.24
98 0.24
99 0.23
100 0.21
101 0.17
102 0.2
103 0.2
104 0.21
105 0.18
106 0.19
107 0.19
108 0.18
109 0.15
110 0.15
111 0.14
112 0.13
113 0.14
114 0.15
115 0.17
116 0.16
117 0.15
118 0.13
119 0.11
120 0.12
121 0.12
122 0.11
123 0.1
124 0.12
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.13
131 0.17
132 0.17
133 0.2
134 0.23
135 0.23
136 0.22
137 0.21
138 0.22
139 0.21
140 0.19
141 0.17
142 0.17
143 0.19
144 0.21
145 0.21
146 0.24
147 0.25
148 0.34
149 0.37
150 0.39
151 0.38
152 0.4
153 0.41
154 0.37
155 0.32
156 0.24
157 0.23
158 0.18
159 0.16
160 0.13
161 0.11
162 0.08
163 0.08
164 0.05
165 0.04
166 0.03
167 0.03
168 0.02
169 0.03
170 0.03
171 0.03
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.07
181 0.06
182 0.06
183 0.06
184 0.06
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.04
204 0.04
205 0.06
206 0.13
207 0.14
208 0.15
209 0.16
210 0.19
211 0.19
212 0.22
213 0.25
214 0.29
215 0.33
216 0.35
217 0.4
218 0.39
219 0.4
220 0.41
221 0.39
222 0.32
223 0.3
224 0.28
225 0.27
226 0.3
227 0.28
228 0.26
229 0.27
230 0.3
231 0.32
232 0.32
233 0.31
234 0.31
235 0.35
236 0.36
237 0.35
238 0.29
239 0.25
240 0.25
241 0.26
242 0.2
243 0.16
244 0.14
245 0.11
246 0.09
247 0.09
248 0.08
249 0.03
250 0.04
251 0.05
252 0.05
253 0.05
254 0.06
255 0.07
256 0.07
257 0.07
258 0.08
259 0.08
260 0.1
261 0.12
262 0.12
263 0.13
264 0.13
265 0.13
266 0.13
267 0.13
268 0.14
269 0.13
270 0.12
271 0.12
272 0.12
273 0.12
274 0.15
275 0.14
276 0.12
277 0.12
278 0.13
279 0.13
280 0.13
281 0.13
282 0.11
283 0.11
284 0.15
285 0.16
286 0.16
287 0.14
288 0.15
289 0.14
290 0.14
291 0.13
292 0.11
293 0.11
294 0.15
295 0.18
296 0.2
297 0.28
298 0.3
299 0.35
300 0.43
301 0.44
302 0.48
303 0.54
304 0.57
305 0.51
306 0.52
307 0.52
308 0.43
309 0.44
310 0.4
311 0.37
312 0.33
313 0.3
314 0.29
315 0.27
316 0.28
317 0.26
318 0.23
319 0.17
320 0.21
321 0.23
322 0.28
323 0.31
324 0.3