Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5IVS9

Protein Details
Accession A0A5N5IVS9    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-56TNYSRRLPCKYNRKGKCRFKNNCANSHDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF14608  zf-CCCH_2  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences RNLAHVPCKFVEGGKICQYGNRCPYSHDTNYSRRLPCKYNRKGKCRFKNNCANSHDIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.31
4 0.34
5 0.36
6 0.35
7 0.38
8 0.36
9 0.3
10 0.31
11 0.37
12 0.41
13 0.4
14 0.4
15 0.38
16 0.4
17 0.46
18 0.5
19 0.47
20 0.43
21 0.45
22 0.45
23 0.49
24 0.54
25 0.58
26 0.62
27 0.69
28 0.75
29 0.82
30 0.87
31 0.89
32 0.89
33 0.88
34 0.87
35 0.89
36 0.87
37 0.86
38 0.79