Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5PN82

Protein Details
Accession A0A5N5PN82    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
210-236ATAQSPKQMKKPNKKQKPPPAAPQPAWHydrophilic
NLS Segment(s)
PositionSequence
217-230QMKKPNKKQKPPPA
320-329LEKKGRGGKR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037830  ZZZ3  
Amino Acid Sequences MPGLTLNTQDVVMQPPPAASSSSSSSARRSSSPTRPPVSPITPTMAHAQLPPQPQPLPPFSQSRQTYTHSQPDQIGMPPPPAPPEPISFDDNPDVLALKSAISILQMQKARATRDIQSLSRAKEAALADTEGFIADLASGKVGTEADRLFPDLAPRRKAAEPLAEEDSDSSDSSHDDEDTAEPSQEQSAGTSTSTPTSPPQKDGSNPAPATAQSPKQMKKPNKKQKPPPAAPQPAWRTLPKPQNVVRCPPINWAQYGVVGESLDKLHAEQQRAPAQGAPAALKPGGEGGGLTYEFKGDGKGEQKALVGVAAPYNPQRDRLEKKGRGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.16
5 0.16
6 0.13
7 0.16
8 0.19
9 0.24
10 0.27
11 0.28
12 0.3
13 0.33
14 0.34
15 0.33
16 0.36
17 0.4
18 0.47
19 0.55
20 0.6
21 0.6
22 0.59
23 0.61
24 0.62
25 0.58
26 0.52
27 0.45
28 0.42
29 0.38
30 0.38
31 0.38
32 0.32
33 0.28
34 0.24
35 0.25
36 0.25
37 0.28
38 0.29
39 0.28
40 0.28
41 0.3
42 0.34
43 0.36
44 0.36
45 0.35
46 0.4
47 0.38
48 0.47
49 0.46
50 0.46
51 0.46
52 0.44
53 0.48
54 0.47
55 0.54
56 0.46
57 0.46
58 0.42
59 0.4
60 0.38
61 0.32
62 0.3
63 0.22
64 0.22
65 0.21
66 0.2
67 0.21
68 0.2
69 0.21
70 0.2
71 0.22
72 0.26
73 0.27
74 0.31
75 0.28
76 0.3
77 0.29
78 0.26
79 0.23
80 0.18
81 0.16
82 0.11
83 0.11
84 0.08
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.09
91 0.09
92 0.15
93 0.17
94 0.17
95 0.21
96 0.24
97 0.26
98 0.26
99 0.28
100 0.25
101 0.31
102 0.35
103 0.31
104 0.35
105 0.37
106 0.35
107 0.34
108 0.31
109 0.24
110 0.25
111 0.25
112 0.19
113 0.16
114 0.15
115 0.13
116 0.13
117 0.13
118 0.07
119 0.07
120 0.05
121 0.04
122 0.03
123 0.04
124 0.03
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.06
132 0.07
133 0.08
134 0.08
135 0.1
136 0.1
137 0.1
138 0.15
139 0.21
140 0.25
141 0.27
142 0.27
143 0.3
144 0.3
145 0.32
146 0.29
147 0.27
148 0.24
149 0.25
150 0.27
151 0.23
152 0.22
153 0.2
154 0.19
155 0.14
156 0.12
157 0.09
158 0.06
159 0.07
160 0.08
161 0.08
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.09
168 0.08
169 0.07
170 0.08
171 0.08
172 0.07
173 0.07
174 0.05
175 0.06
176 0.07
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.09
183 0.12
184 0.19
185 0.21
186 0.23
187 0.26
188 0.27
189 0.29
190 0.35
191 0.36
192 0.36
193 0.35
194 0.32
195 0.3
196 0.28
197 0.29
198 0.26
199 0.24
200 0.22
201 0.28
202 0.3
203 0.37
204 0.46
205 0.53
206 0.61
207 0.69
208 0.75
209 0.8
210 0.87
211 0.9
212 0.92
213 0.93
214 0.89
215 0.87
216 0.87
217 0.84
218 0.76
219 0.75
220 0.69
221 0.63
222 0.6
223 0.52
224 0.45
225 0.45
226 0.51
227 0.46
228 0.49
229 0.48
230 0.55
231 0.57
232 0.61
233 0.58
234 0.54
235 0.5
236 0.49
237 0.51
238 0.43
239 0.4
240 0.36
241 0.31
242 0.28
243 0.28
244 0.22
245 0.15
246 0.13
247 0.12
248 0.1
249 0.09
250 0.08
251 0.07
252 0.08
253 0.14
254 0.18
255 0.22
256 0.24
257 0.31
258 0.37
259 0.39
260 0.39
261 0.34
262 0.31
263 0.29
264 0.27
265 0.22
266 0.17
267 0.17
268 0.17
269 0.14
270 0.13
271 0.12
272 0.11
273 0.09
274 0.08
275 0.07
276 0.1
277 0.1
278 0.11
279 0.1
280 0.1
281 0.1
282 0.11
283 0.11
284 0.09
285 0.14
286 0.19
287 0.23
288 0.24
289 0.25
290 0.26
291 0.25
292 0.24
293 0.19
294 0.15
295 0.11
296 0.12
297 0.11
298 0.13
299 0.15
300 0.22
301 0.22
302 0.27
303 0.31
304 0.38
305 0.46
306 0.54
307 0.62
308 0.63
309 0.72