Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DCX9

Protein Details
Accession C5DCX9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-111IQRFKKRYSASLLKKKRRGGGKFBasic
NLS Segment(s)
PositionSequence
97-110SASLLKKKRRGGGK
Subcellular Location(s) plas 10, extr 7, golg 3, mito 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001142  DUP/COS  
Gene Ontology GO:0016020  C:membrane  
KEGG lth:KLTH0B06688g  -  
Pfam View protein in Pfam  
PF00674  DUP  
Amino Acid Sequences MVSPVITIFRIVLAMALSNLFLGFVLFSPLRDNGLGASDLMDLWTTIAAVEPRGDTRGWDRIASYINEYLITNGAPGRLAQFYDGEDCIQRFKKRYSASLLKKKRRGGGKFEDLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.08
13 0.08
14 0.08
15 0.11
16 0.11
17 0.13
18 0.12
19 0.12
20 0.09
21 0.11
22 0.11
23 0.08
24 0.09
25 0.07
26 0.07
27 0.07
28 0.07
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.05
38 0.06
39 0.06
40 0.08
41 0.08
42 0.08
43 0.1
44 0.16
45 0.16
46 0.16
47 0.16
48 0.16
49 0.18
50 0.18
51 0.18
52 0.13
53 0.12
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.1
70 0.12
71 0.12
72 0.11
73 0.12
74 0.12
75 0.17
76 0.22
77 0.25
78 0.27
79 0.3
80 0.38
81 0.41
82 0.46
83 0.5
84 0.55
85 0.62
86 0.69
87 0.76
88 0.78
89 0.82
90 0.83
91 0.81
92 0.81
93 0.76
94 0.75
95 0.74
96 0.75