Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DMI3

Protein Details
Accession C5DMI3    Localization Confidence High Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-84RERDAHSIKKREQRNRRKLQRARQLAEBasic
142-171LRNTSQRSSLQKRKRKQRRDDFDESKKPVSHydrophilic
NLS Segment(s)
PositionSequence
52-79KKAVRVRERDAHSIKKREQRNRRKLQRA
153-159KRKRKQR
Subcellular Location(s) nucl 20, mito 4, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
KEGG lth:KLTH0G09174g  -  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MSSASAKAQATAAVNNVLSLVLPGSAKIDHNSTKRQNNSKGSKAQLINANLKKAVRVRERDAHSIKKREQRNRRKLQRARQLAEDKVDQQAKLDILRKHREEDSLTAKERKFLNKVINKNVRDLKSWDVDAEELHELQESVLRNTSQRSSLQKRKRKQRRDDFDESKKPVSGDHRYPGLTPGLAPVGLSDEEDSDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.12
5 0.1
6 0.09
7 0.07
8 0.06
9 0.06
10 0.06
11 0.08
12 0.09
13 0.1
14 0.12
15 0.17
16 0.22
17 0.27
18 0.36
19 0.43
20 0.5
21 0.58
22 0.65
23 0.69
24 0.72
25 0.76
26 0.74
27 0.73
28 0.68
29 0.68
30 0.6
31 0.56
32 0.53
33 0.5
34 0.52
35 0.48
36 0.46
37 0.39
38 0.38
39 0.36
40 0.33
41 0.37
42 0.36
43 0.39
44 0.43
45 0.5
46 0.55
47 0.6
48 0.61
49 0.63
50 0.62
51 0.64
52 0.65
53 0.64
54 0.68
55 0.7
56 0.76
57 0.77
58 0.8
59 0.84
60 0.87
61 0.9
62 0.9
63 0.9
64 0.89
65 0.87
66 0.79
67 0.76
68 0.71
69 0.62
70 0.56
71 0.47
72 0.37
73 0.33
74 0.31
75 0.22
76 0.18
77 0.18
78 0.15
79 0.17
80 0.21
81 0.19
82 0.25
83 0.31
84 0.32
85 0.33
86 0.33
87 0.33
88 0.29
89 0.3
90 0.31
91 0.29
92 0.3
93 0.32
94 0.31
95 0.33
96 0.34
97 0.34
98 0.3
99 0.3
100 0.38
101 0.4
102 0.46
103 0.51
104 0.58
105 0.54
106 0.57
107 0.59
108 0.52
109 0.47
110 0.45
111 0.39
112 0.33
113 0.32
114 0.27
115 0.21
116 0.19
117 0.16
118 0.16
119 0.13
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.11
126 0.09
127 0.09
128 0.12
129 0.12
130 0.13
131 0.16
132 0.18
133 0.18
134 0.21
135 0.29
136 0.37
137 0.47
138 0.57
139 0.64
140 0.71
141 0.8
142 0.86
143 0.88
144 0.89
145 0.9
146 0.91
147 0.91
148 0.92
149 0.9
150 0.89
151 0.88
152 0.82
153 0.73
154 0.64
155 0.55
156 0.49
157 0.47
158 0.45
159 0.43
160 0.43
161 0.45
162 0.44
163 0.45
164 0.43
165 0.38
166 0.29
167 0.23
168 0.2
169 0.17
170 0.16
171 0.15
172 0.12
173 0.13
174 0.13
175 0.14
176 0.11
177 0.1