Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5L1F6

Protein Details
Accession A0A5N5L1F6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
52-81FTSHRKWPVRHTPPRPPRARRGIPPPARKTBasic
NLS Segment(s)
PositionSequence
57-80KWPVRHTPPRPPRARRGIPPPARK
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MSGPILLSFLSSLTHTPSYTPQQHLQPQLHNLTLSTSPFLQTQPTNPQPLFFTSHRKWPVRHTPPRPPRARRGIPPPARKTSPSSTSISPSSTRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.2
5 0.27
6 0.31
7 0.35
8 0.36
9 0.41
10 0.47
11 0.52
12 0.51
13 0.47
14 0.47
15 0.45
16 0.41
17 0.34
18 0.28
19 0.24
20 0.21
21 0.18
22 0.14
23 0.11
24 0.11
25 0.12
26 0.12
27 0.12
28 0.11
29 0.14
30 0.21
31 0.23
32 0.26
33 0.25
34 0.25
35 0.24
36 0.26
37 0.28
38 0.21
39 0.27
40 0.25
41 0.34
42 0.4
43 0.42
44 0.41
45 0.45
46 0.54
47 0.56
48 0.65
49 0.65
50 0.69
51 0.76
52 0.85
53 0.86
54 0.81
55 0.8
56 0.81
57 0.8
58 0.76
59 0.76
60 0.77
61 0.77
62 0.81
63 0.79
64 0.76
65 0.73
66 0.68
67 0.65
68 0.63
69 0.59
70 0.53
71 0.5
72 0.45
73 0.46
74 0.45
75 0.41