Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DJY7

Protein Details
Accession C5DJY7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
3-33STKPSFKVLIKKKGKTLNRRLKNSSKSYRENHydrophilic
NLS Segment(s)
PositionSequence
13-22KKKGKTLNRR
Subcellular Location(s) nucl 14, mito_nucl 12.999, mito 10.5, cyto_nucl 9.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006856  MATalpha_HMGbox  
Gene Ontology GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0045895  P:positive regulation of mating-type specific transcription, DNA-templated  
KEGG lth:KLTH0F00374g  -  
Pfam View protein in Pfam  
PF04769  MATalpha_HMGbox  
PROSITE View protein in PROSITE  
PS51325  ALPHA_BOX  
Amino Acid Sequences MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENYQQSYEESELDSECMAKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSSILQCDQVPYYPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.81
4 0.81
5 0.83
6 0.83
7 0.83
8 0.86
9 0.86
10 0.86
11 0.86
12 0.85
13 0.84
14 0.82
15 0.79
16 0.76
17 0.76
18 0.7
19 0.63
20 0.56
21 0.51
22 0.44
23 0.37
24 0.35
25 0.28
26 0.24
27 0.24
28 0.22
29 0.18
30 0.2
31 0.26
32 0.3
33 0.38
34 0.47
35 0.5
36 0.57
37 0.58
38 0.6
39 0.57
40 0.55
41 0.49
42 0.48
43 0.51
44 0.44
45 0.45
46 0.42
47 0.42
48 0.43
49 0.47
50 0.48
51 0.51
52 0.58
53 0.66
54 0.72
55 0.78
56 0.74
57 0.72
58 0.68
59 0.67
60 0.65
61 0.61
62 0.57
63 0.49
64 0.47
65 0.49
66 0.45
67 0.4
68 0.33
69 0.27
70 0.23
71 0.26
72 0.25
73 0.23
74 0.25
75 0.23
76 0.3
77 0.35
78 0.37
79 0.36
80 0.36
81 0.36
82 0.38
83 0.4
84 0.39
85 0.4
86 0.4
87 0.42
88 0.46
89 0.47
90 0.41
91 0.37
92 0.36
93 0.31
94 0.32
95 0.3
96 0.28
97 0.23
98 0.27
99 0.35
100 0.36
101 0.42
102 0.46
103 0.51
104 0.5
105 0.52
106 0.55
107 0.49
108 0.44
109 0.38
110 0.31
111 0.24
112 0.24
113 0.23
114 0.16
115 0.19
116 0.21
117 0.21
118 0.23
119 0.25
120 0.26
121 0.25
122 0.29
123 0.27
124 0.25
125 0.25
126 0.27
127 0.27
128 0.23
129 0.29
130 0.25
131 0.23
132 0.23
133 0.23
134 0.18
135 0.19
136 0.19
137 0.14
138 0.17
139 0.15
140 0.13
141 0.13
142 0.13
143 0.13
144 0.14
145 0.13
146 0.12
147 0.15
148 0.16
149 0.16
150 0.17
151 0.15
152 0.14
153 0.14
154 0.13
155 0.1
156 0.09
157 0.09
158 0.09
159 0.09
160 0.09
161 0.08
162 0.08
163 0.09
164 0.09
165 0.11
166 0.14
167 0.17
168 0.2
169 0.2
170 0.24
171 0.27
172 0.27
173 0.26
174 0.23
175 0.22
176 0.19
177 0.18
178 0.13
179 0.08
180 0.08
181 0.07
182 0.07
183 0.08
184 0.09
185 0.1
186 0.12
187 0.14
188 0.15
189 0.17
190 0.17
191 0.16
192 0.18
193 0.17
194 0.19
195 0.22
196 0.22
197 0.2
198 0.19
199 0.18
200 0.16
201 0.16
202 0.14
203 0.1
204 0.13
205 0.14
206 0.15
207 0.15
208 0.15
209 0.15
210 0.17
211 0.21
212 0.24
213 0.23
214 0.26
215 0.28
216 0.29
217 0.3
218 0.3
219 0.26
220 0.22
221 0.22
222 0.21
223 0.21
224 0.21
225 0.21
226 0.19
227 0.17
228 0.18
229 0.18