Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75A50

Protein Details
Accession Q75A50    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
506-549NYQILKNKGLTPKRKKDNRNSRVKKRKKFEKAQKKLKSVRAVYSHydrophilic
NLS Segment(s)
PositionSequence
348-349KK
512-543NKGLTPKRKKDNRNSRVKKRKKFEKAQKKLKS
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
IPR018972  Sas10_C_dom  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0042802  F:identical protein binding  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ago:AGOS_ADR069C  -  
Pfam View protein in Pfam  
PF09368  Sas10  
Amino Acid Sequences MKTRNSAKGVSSEDPYGANEVDDFAAKREKVMLEEAGLDGRSDSDDSDVPDEQEDEVMAMTDDSSDEDSALDGEEAYKRVFGRRLDADIEEAEQGDMLDNEAAWGSTKNDYYGADDLDDEDAAREIEKEALQQQRKHLEELNMGDFLEDEIEQDWVKEAKAFDIGEFQASTQQTSVSVADVLNMSIEGKESFLNTSFPEFYPLCKDFEKRNAELELLKEDDQTEVNRLRIMALSSYLGTIASYFAIFLHELKTNEDFSTMKDHPIMESILMSREMWRQAKELPADAVVPEGEEQVSEDEEEPNSVYEYEAPMEESGDEQEQDMSAESAEGDSDVQEELDIDVSKPRIKKSHKKAATQDADDFAESEITEVDAQEKQKRRKTLRFYTSKIDQKANKTEKFKGDDDIPYKERLFERQQRLLEEARKRGVHDKNGADLQNDEFNSDDERTAQSVNAEAVDDYYAQVSASRVAKKETRMKAHKDALRAVREGKLSELAEEVDEHGKRAINYQILKNKGLTPKRKKDNRNSRVKKRKKFEKAQKKLKSVRAVYSGGQNGAYEGEQTGIRKNVTKSVKFRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.26
4 0.2
5 0.17
6 0.13
7 0.13
8 0.13
9 0.14
10 0.14
11 0.13
12 0.2
13 0.2
14 0.21
15 0.24
16 0.24
17 0.25
18 0.28
19 0.27
20 0.21
21 0.23
22 0.23
23 0.2
24 0.19
25 0.16
26 0.12
27 0.11
28 0.11
29 0.1
30 0.1
31 0.11
32 0.12
33 0.15
34 0.18
35 0.19
36 0.18
37 0.19
38 0.19
39 0.16
40 0.15
41 0.13
42 0.09
43 0.08
44 0.08
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.06
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.07
59 0.05
60 0.07
61 0.09
62 0.1
63 0.11
64 0.13
65 0.13
66 0.18
67 0.23
68 0.24
69 0.29
70 0.32
71 0.35
72 0.36
73 0.36
74 0.34
75 0.29
76 0.29
77 0.22
78 0.18
79 0.14
80 0.1
81 0.1
82 0.08
83 0.07
84 0.06
85 0.06
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.12
94 0.12
95 0.13
96 0.15
97 0.15
98 0.18
99 0.2
100 0.18
101 0.15
102 0.15
103 0.15
104 0.14
105 0.14
106 0.1
107 0.08
108 0.07
109 0.07
110 0.07
111 0.06
112 0.06
113 0.09
114 0.09
115 0.11
116 0.17
117 0.26
118 0.32
119 0.35
120 0.4
121 0.47
122 0.48
123 0.49
124 0.48
125 0.43
126 0.42
127 0.43
128 0.39
129 0.3
130 0.28
131 0.25
132 0.21
133 0.16
134 0.12
135 0.08
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.1
145 0.1
146 0.1
147 0.14
148 0.14
149 0.13
150 0.16
151 0.16
152 0.15
153 0.15
154 0.14
155 0.16
156 0.16
157 0.16
158 0.12
159 0.12
160 0.11
161 0.12
162 0.12
163 0.08
164 0.08
165 0.08
166 0.08
167 0.08
168 0.08
169 0.06
170 0.06
171 0.06
172 0.05
173 0.06
174 0.05
175 0.05
176 0.06
177 0.07
178 0.08
179 0.08
180 0.1
181 0.1
182 0.12
183 0.14
184 0.13
185 0.17
186 0.16
187 0.17
188 0.23
189 0.23
190 0.24
191 0.24
192 0.26
193 0.26
194 0.35
195 0.41
196 0.35
197 0.37
198 0.35
199 0.35
200 0.34
201 0.3
202 0.24
203 0.2
204 0.18
205 0.15
206 0.14
207 0.14
208 0.13
209 0.13
210 0.14
211 0.13
212 0.14
213 0.14
214 0.14
215 0.13
216 0.13
217 0.13
218 0.1
219 0.08
220 0.09
221 0.08
222 0.08
223 0.08
224 0.06
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.04
232 0.05
233 0.05
234 0.05
235 0.07
236 0.1
237 0.11
238 0.13
239 0.15
240 0.15
241 0.15
242 0.16
243 0.14
244 0.12
245 0.19
246 0.17
247 0.16
248 0.16
249 0.17
250 0.15
251 0.17
252 0.16
253 0.09
254 0.09
255 0.08
256 0.08
257 0.08
258 0.08
259 0.08
260 0.1
261 0.14
262 0.16
263 0.16
264 0.17
265 0.18
266 0.22
267 0.21
268 0.2
269 0.16
270 0.15
271 0.14
272 0.13
273 0.11
274 0.07
275 0.06
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.04
282 0.05
283 0.05
284 0.05
285 0.06
286 0.06
287 0.06
288 0.06
289 0.06
290 0.06
291 0.06
292 0.05
293 0.05
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.05
306 0.06
307 0.05
308 0.06
309 0.05
310 0.05
311 0.04
312 0.04
313 0.04
314 0.04
315 0.03
316 0.03
317 0.03
318 0.03
319 0.04
320 0.04
321 0.03
322 0.03
323 0.04
324 0.04
325 0.05
326 0.05
327 0.05
328 0.07
329 0.09
330 0.12
331 0.14
332 0.17
333 0.24
334 0.32
335 0.42
336 0.51
337 0.61
338 0.65
339 0.71
340 0.75
341 0.78
342 0.76
343 0.68
344 0.6
345 0.51
346 0.44
347 0.36
348 0.3
349 0.19
350 0.13
351 0.1
352 0.08
353 0.05
354 0.05
355 0.05
356 0.05
357 0.07
358 0.09
359 0.11
360 0.18
361 0.26
362 0.34
363 0.4
364 0.49
365 0.56
366 0.63
367 0.71
368 0.75
369 0.77
370 0.78
371 0.75
372 0.73
373 0.73
374 0.71
375 0.65
376 0.61
377 0.56
378 0.54
379 0.61
380 0.62
381 0.6
382 0.58
383 0.6
384 0.6
385 0.61
386 0.55
387 0.48
388 0.44
389 0.44
390 0.42
391 0.43
392 0.38
393 0.36
394 0.35
395 0.35
396 0.32
397 0.31
398 0.37
399 0.4
400 0.46
401 0.51
402 0.53
403 0.51
404 0.54
405 0.53
406 0.52
407 0.49
408 0.46
409 0.45
410 0.43
411 0.44
412 0.49
413 0.5
414 0.5
415 0.51
416 0.48
417 0.47
418 0.51
419 0.5
420 0.42
421 0.36
422 0.3
423 0.28
424 0.25
425 0.21
426 0.16
427 0.16
428 0.18
429 0.18
430 0.16
431 0.12
432 0.13
433 0.14
434 0.14
435 0.14
436 0.12
437 0.12
438 0.12
439 0.11
440 0.1
441 0.09
442 0.09
443 0.09
444 0.08
445 0.07
446 0.07
447 0.07
448 0.06
449 0.07
450 0.07
451 0.11
452 0.16
453 0.19
454 0.2
455 0.25
456 0.29
457 0.36
458 0.46
459 0.5
460 0.55
461 0.6
462 0.67
463 0.72
464 0.77
465 0.72
466 0.68
467 0.68
468 0.65
469 0.62
470 0.56
471 0.49
472 0.45
473 0.43
474 0.39
475 0.33
476 0.3
477 0.26
478 0.24
479 0.22
480 0.18
481 0.17
482 0.16
483 0.16
484 0.17
485 0.17
486 0.17
487 0.18
488 0.19
489 0.19
490 0.22
491 0.25
492 0.26
493 0.31
494 0.38
495 0.45
496 0.46
497 0.48
498 0.47
499 0.48
500 0.51
501 0.56
502 0.59
503 0.62
504 0.68
505 0.77
506 0.85
507 0.88
508 0.9
509 0.92
510 0.92
511 0.92
512 0.92
513 0.93
514 0.94
515 0.95
516 0.94
517 0.93
518 0.94
519 0.94
520 0.94
521 0.94
522 0.94
523 0.95
524 0.95
525 0.95
526 0.94
527 0.92
528 0.9
529 0.88
530 0.82
531 0.79
532 0.74
533 0.67
534 0.59
535 0.58
536 0.52
537 0.43
538 0.38
539 0.3
540 0.24
541 0.23
542 0.21
543 0.13
544 0.1
545 0.1
546 0.12
547 0.13
548 0.18
549 0.2
550 0.22
551 0.27
552 0.29
553 0.37
554 0.44
555 0.52