Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5J9W4

Protein Details
Accession A0A5N5J9W4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-55TTEPRSDPKQKAKERTRNNQKRCREKKKEHLQELQAHydrophilic
NLS Segment(s)
PositionSequence
28-47KQKAKERTRNNQKRCREKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MRKLPLPIDEQTPGASEVETTEPRSDPKQKAKERTRNNQKRCREKKKEHLQELQAKLREHEQQKMKATIEMQRAALKVIKENEELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.11
4 0.11
5 0.15
6 0.15
7 0.16
8 0.17
9 0.17
10 0.2
11 0.25
12 0.31
13 0.34
14 0.43
15 0.51
16 0.57
17 0.67
18 0.75
19 0.8
20 0.81
21 0.85
22 0.86
23 0.87
24 0.89
25 0.88
26 0.86
27 0.87
28 0.89
29 0.88
30 0.87
31 0.86
32 0.87
33 0.89
34 0.9
35 0.86
36 0.83
37 0.79
38 0.78
39 0.74
40 0.7
41 0.63
42 0.53
43 0.46
44 0.43
45 0.43
46 0.37
47 0.39
48 0.4
49 0.42
50 0.47
51 0.51
52 0.48
53 0.43
54 0.43
55 0.42
56 0.41
57 0.36
58 0.32
59 0.31
60 0.31
61 0.3
62 0.31
63 0.25
64 0.25
65 0.28
66 0.3