Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LWN6

Protein Details
Accession A0A5N5LWN6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-94ADCANIHRKRARRDNRIVKARRRSFGHydrophilic
NLS Segment(s)
PositionSequence
76-93RKRARRDNRIVKARRRSF
Subcellular Location(s) extr 8, nucl 7, cyto 5, mito 4, plas 3
Family & Domain DBs
Amino Acid Sequences MVTSIHASRLFPLLLFVELWAQQSISIHLPREGGKVLPCPRVLRICPQRVRTTQSPPLRRLLASHSCCADCANIHRKRARRDNRIVKARRRSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.11
6 0.13
7 0.11
8 0.1
9 0.09
10 0.1
11 0.12
12 0.14
13 0.15
14 0.14
15 0.15
16 0.16
17 0.17
18 0.19
19 0.17
20 0.14
21 0.14
22 0.21
23 0.24
24 0.26
25 0.27
26 0.26
27 0.28
28 0.32
29 0.31
30 0.34
31 0.38
32 0.43
33 0.47
34 0.5
35 0.53
36 0.51
37 0.56
38 0.51
39 0.5
40 0.5
41 0.53
42 0.55
43 0.51
44 0.53
45 0.48
46 0.44
47 0.38
48 0.37
49 0.38
50 0.35
51 0.35
52 0.33
53 0.32
54 0.32
55 0.31
56 0.24
57 0.16
58 0.21
59 0.28
60 0.32
61 0.39
62 0.45
63 0.52
64 0.61
65 0.7
66 0.73
67 0.74
68 0.79
69 0.83
70 0.87
71 0.91
72 0.9
73 0.9
74 0.9