Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MTP7

Protein Details
Accession A0A5N5MTP7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SSQANQSKKAHRNGIKKPKTHydrophilic
NLS Segment(s)
PositionSequence
14-61KKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTQKALKEFKEGK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQANQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTQKALKEFKEGKRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.72
4 0.71
5 0.74
6 0.76
7 0.8
8 0.79
9 0.79
10 0.79
11 0.79
12 0.79
13 0.76
14 0.75
15 0.73
16 0.7
17 0.67
18 0.64
19 0.6
20 0.57
21 0.54
22 0.55
23 0.5
24 0.53
25 0.56
26 0.61
27 0.65
28 0.66
29 0.72
30 0.66
31 0.71
32 0.67
33 0.68
34 0.69
35 0.65
36 0.62
37 0.56
38 0.55
39 0.5
40 0.48
41 0.39
42 0.39
43 0.41
44 0.46
45 0.52