Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q756S4

Protein Details
Accession Q756S4    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-101GWRDARHLNYKRAKKLRKTKHKGSFVKFBasic
NLS Segment(s)
PositionSequence
13-18AKSVKR
84-96KRAKKLRKTKHKG
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG ago:AGOS_AER180W  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRAKTHLKAKSVKRKGVFQKTTDERAQRLAEKLKSNLLEQKAGAQPDGKMEIDGDSTASTEKVAKVSTSGWRDARHLNYKRAKKLRKTKHKGSFVKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.76
4 0.7
5 0.73
6 0.77
7 0.8
8 0.75
9 0.67
10 0.68
11 0.65
12 0.67
13 0.63
14 0.56
15 0.46
16 0.45
17 0.45
18 0.37
19 0.36
20 0.37
21 0.36
22 0.36
23 0.36
24 0.36
25 0.34
26 0.33
27 0.35
28 0.3
29 0.26
30 0.23
31 0.26
32 0.24
33 0.22
34 0.21
35 0.16
36 0.14
37 0.14
38 0.16
39 0.11
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.07
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.06
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.12
58 0.19
59 0.21
60 0.25
61 0.27
62 0.28
63 0.32
64 0.36
65 0.42
66 0.45
67 0.47
68 0.52
69 0.59
70 0.66
71 0.73
72 0.78
73 0.8
74 0.8
75 0.85
76 0.87
77 0.89
78 0.9
79 0.9
80 0.91
81 0.92