Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5KF62

Protein Details
Accession A0A5N5KF62    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-45APTPAPPAPPKKPTRRQVNQELRQAAHydrophilic
108-128LEKAKAKSRKTRKNANKSAAAHydrophilic
NLS Segment(s)
PositionSequence
93-124KDRRARREEAERKRLLEKAKAKSRKTRKNANK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MADQPAQAPPAQPSATAQPAPTPAPPAPPKKPTRRQVNQELRQAAADRRRQQQRENMRTKSKAKEDFWLCEYCEYEAIFGEPPRALIRQYEIKDRRARREEAERKRLLEKAKAKSRKTRKNANKSAAAAKDTATVSASQDKNAPHAVVGPPPAPPTDGPGPEDEGYEDPEGYDGEGGNDAEDVHDGGDGWEENSDAMGWKEGGPQEERDRDGEHKSDEDKGKRTEPEPGGLAVGDEGTGNGVATEDGQAVHSTTAVQENQSDNKPAATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.3
4 0.28
5 0.25
6 0.28
7 0.3
8 0.29
9 0.28
10 0.23
11 0.31
12 0.38
13 0.43
14 0.48
15 0.55
16 0.63
17 0.69
18 0.79
19 0.79
20 0.83
21 0.85
22 0.86
23 0.88
24 0.89
25 0.87
26 0.85
27 0.78
28 0.67
29 0.59
30 0.53
31 0.48
32 0.45
33 0.46
34 0.43
35 0.51
36 0.59
37 0.61
38 0.66
39 0.69
40 0.72
41 0.74
42 0.76
43 0.75
44 0.73
45 0.76
46 0.76
47 0.74
48 0.72
49 0.7
50 0.63
51 0.65
52 0.61
53 0.58
54 0.55
55 0.5
56 0.41
57 0.35
58 0.33
59 0.25
60 0.22
61 0.18
62 0.14
63 0.12
64 0.12
65 0.11
66 0.11
67 0.11
68 0.09
69 0.1
70 0.12
71 0.12
72 0.11
73 0.11
74 0.15
75 0.22
76 0.24
77 0.33
78 0.35
79 0.42
80 0.5
81 0.54
82 0.59
83 0.57
84 0.58
85 0.53
86 0.61
87 0.64
88 0.66
89 0.7
90 0.63
91 0.6
92 0.59
93 0.58
94 0.5
95 0.49
96 0.47
97 0.46
98 0.54
99 0.6
100 0.61
101 0.67
102 0.74
103 0.76
104 0.75
105 0.76
106 0.77
107 0.8
108 0.85
109 0.81
110 0.75
111 0.67
112 0.66
113 0.57
114 0.48
115 0.37
116 0.28
117 0.26
118 0.2
119 0.18
120 0.12
121 0.1
122 0.1
123 0.16
124 0.16
125 0.13
126 0.16
127 0.16
128 0.18
129 0.18
130 0.17
131 0.1
132 0.13
133 0.13
134 0.12
135 0.13
136 0.12
137 0.11
138 0.12
139 0.12
140 0.11
141 0.1
142 0.14
143 0.16
144 0.17
145 0.18
146 0.18
147 0.21
148 0.2
149 0.2
150 0.16
151 0.13
152 0.14
153 0.13
154 0.12
155 0.09
156 0.09
157 0.09
158 0.07
159 0.07
160 0.04
161 0.05
162 0.06
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.06
185 0.07
186 0.07
187 0.11
188 0.12
189 0.15
190 0.16
191 0.2
192 0.26
193 0.29
194 0.31
195 0.29
196 0.31
197 0.32
198 0.34
199 0.33
200 0.29
201 0.28
202 0.29
203 0.34
204 0.39
205 0.42
206 0.43
207 0.44
208 0.48
209 0.49
210 0.48
211 0.5
212 0.45
213 0.43
214 0.39
215 0.35
216 0.3
217 0.26
218 0.25
219 0.15
220 0.12
221 0.08
222 0.06
223 0.05
224 0.05
225 0.05
226 0.05
227 0.04
228 0.05
229 0.04
230 0.05
231 0.06
232 0.06
233 0.06
234 0.07
235 0.08
236 0.09
237 0.09
238 0.09
239 0.08
240 0.09
241 0.14
242 0.14
243 0.15
244 0.17
245 0.22
246 0.27
247 0.3
248 0.32
249 0.27